KEGG   Escherichia coli B REL606: ECB_02490Help
Entry
ECB_02490         CDS       T00944                                 

Gene name
aroF
Definition
(GenBank) 3-deoxy-D-arabino-heptulosonate-7-phosphate synthase, tyrosine-repressible
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
ebr  Escherichia coli B REL606
Pathway
ebr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ebr01100  Metabolic pathways
ebr01110  Biosynthesis of secondary metabolites
ebr01130  Biosynthesis of antibiotics
ebr01230  Biosynthesis of amino acids
ebr02024  Quorum sensing
Module
ebr_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:ebr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ECB_02490 (aroF)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ECB_02490 (aroF)
Enzymes [BR:ebr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     ECB_02490 (aroF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAHP_synth_1
Motif
Other DBs
NCBI-ProteinID: ACT40143
LinkDB All DBs
Structure
PDB: 

Position
complement(2661487..2662557)
Genome map
AA seq 356 aa AA seqDB search
MQKDALNNVHITDEQVLMTPEQLKAAFPLSLQQEAQIADSRKTISDIIAGRDPRLLVVCG
PCSIHDPETALEYARRFKALAAEVSDSLYLVMRVYFEKPRTTVGWKGLINDPHMDGSFDV
EAGLQIARKLLLELVNMGLPLATEALDPNSPQYLGDLFSWSAIGARTTESQTHREMASGL
SMPVGFKNGTDGSLATAINAMRAAAQPHRFVGINQAGQVALLQTQGNPDGHVILRGGKAP
NYSPADVAQCEKEMEQAGLRPSLMVDCSHGNSNKDYRRQPAVAESVVAQIKDGNRSIIGL
MIESNIHEGNQSSEQPRSEMKYGVSVTDACISWEMTDALLREIHQDLNGQLTARVA
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaagacgcgctgaataacgtacatattaccgacgaacaggttttaatgactccg
gaacaactgaaggccgcttttccattgagcctgcaacaagaagcccagattgctgactcg
cgtaaaaccatttcagatattatcgccgggcgcgatcctcgtctgctggtagtatgtggt
ccttgttccattcatgatccggaaactgctctggaatatgctcgtcgatttaaagccctt
gccgcagaggtcagcgatagcctctatctggtaatgcgcgtctattttgaaaaaccccgt
accactgtcggctggaaagggttaattaacgatccccatatggatggctcttttgatgta
gaagccgggctgcagatcgcgcgtaaattgctgcttgagctggtgaatatgggactgcca
ctggcgacggaagcgttagatccgaatagcccgcaatacctgggcgatctgtttagctgg
tcagcaattggtgctcgtacaacggaatcgcaaactcaccgtgaaatggcctccgggctt
tccatgccggttggttttaaaaacggcaccgacggcagtctggcaacagcaattaacgct
atgcgcgccgccgcccagccgcaccgttttgttggcattaaccaggcagggcaggttgcg
ttgctacaaactcaggggaatccggacggccatgtgatcctgcgcggtggtaaagcgccg
aactatagccctgcggatgttgcgcaatgtgaaaaagagatggaacaggcgggactgcgc
ccgtctctgatggtagattgcagccacggtaattccaataaagattatcgccgtcagcct
gcggtggcagaatccgtggttgctcaaatcaaagatggcaatcgctcaattattggtctg
atgatcgaaagtaatatccacgagggcaatcagtcttccgagcaaccgcgcagtgaaatg
aaatacggtgtatccgtaaccgatgcctgcattagctgggaaatgaccgatgccttgctg
cgtgaaattcatcaggatctgaacgggcagctgacggctcgcgtggcttaa

DBGET integrated database retrieval system