KEGG   Ectothiorhodospira sp. BSL-9: ECTOBSL9_0021Help
Entry
ECTOBSL9_0021     CDS       T04374                                 

Gene name
chlL
Definition
(GenBank) protochlorophyllide oxidoreductase
  KO
K04037  light-independent protochlorophyllide reductase subunit L [EC:1.3.7.7]
Organism
ebs  Ectothiorhodospira sp. BSL-9
Pathway
ebs00860  Porphyrin and chlorophyll metabolism
ebs01100  Metabolic pathways
ebs01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ebs00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ECTOBSL9_0021 (chlL)
Enzymes [BR:ebs01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     ECTOBSL9_0021 (chlL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_NifH CbiA AAA_31 ArsA_ATPase ParA MeaB AAA_24 AAA_26 MipZ AAA_25 SRP54 AAA_16 ABC_tran RNA_helicase NB-ARC CBP_BcsQ
Motif
Other DBs
NCBI-ProteinID: ANB01014
UniProt: A0A167BJ97
LinkDB All DBs
Position
complement(16937..17833)
Genome map
AA seq 298 aa AA seqDB search
MNSTCNNDCPAPPDGEGSVQVSMDPNLHIGKAKVFAIYGKGGIGKSTTSSNLSAAFSRLG
KRVIQIGCDPKHDSTFTLTKSMVPTVIDVLESVNFHEEELRPEDFVFEGYNGVMCVEAGG
PPAGTGCGGYVVGQTVKLLKQHHLLEDADVVVFDVLGDVVCGGFAAPLQHAHQALIVTAN
DFDSIFALNRIAAAIEAKAKNYQVRIGGVIANRSENTDEIDRFNNAVGLNRLAHFPLLDV
IRRSRLKKSTVFEMDDEPELRTAQAEYMRLAQSLLDGVQSQRATPMKDRDIFDFLGFD
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
gtgaactcgacttgcaataacgactgccccgcaccgccggacggcgagggcagcgtacag
gtatccatggaccccaatctgcacattggcaaggccaaggtgtttgccatttatggcaag
gggggcattggcaagagtaccacctcgtccaacctgtccgccgccttctcgcgactgggc
aagcgggtgatccagatcggctgcgaccccaagcacgactcgaccttcaccctgaccaag
tccatggtgcccacggtcatcgatgtgcttgagtccgtgaactttcatgaggaagagctg
cgccccgaggattttgtcttcgagggctacaacggcgtcatgtgcgtggaggccggaggc
cccccggcgggtaccgggtgtggtggctacgtggtgggccagacggtcaagctgctcaag
cagcaccatctgctggaagacgccgatgtggtggtcttcgatgtgctcggcgacgtggtc
tgcggcggctttgccgccccattgcagcatgcccatcaggcgctgattgtcactgccaac
gattttgattccatcttcgcgctgaaccgtatcgctgcggccatcgaggccaaggccaag
aattaccaggtgcgcatcggcggggtgatcgccaaccgcagcgaaaacaccgatgagatc
gaccgtttcaataatgccgtgggtctcaatcgcctggcgcacttcccgttgctggatgtg
atccgccgcagccgcctgaaaaagtccaccgtcttcgagatggacgacgagccggaactg
agaacggcccaggccgagtacatgcgcctggctcagagtctgctggatggtgtgcaatca
cagcgcgccacgccgatgaaggatcgggatatctttgattttctgggcttcgattga

DBGET integrated database retrieval system