KEGG   Ectothiorhodospira sp. BSL-9: ECTOBSL9_0484Help
Entry
ECTOBSL9_0484     CDS       T04374                                 

Definition
(GenBank) PBS lyase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ebs  Ectothiorhodospira sp. BSL-9
Brite
KEGG Orthology (KO) [BR:ebs00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ebs01001]
    ECTOBSL9_0484
Enzymes [BR:ebs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     ECTOBSL9_0484
Protein kinases [BR:ebs01001]
 Serine/threonine kinases: Other
  Bacterial family
   ECTOBSL9_0484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase HEAT_2 Pkinase_Tyr HEAT HEAT_PBS Adaptin_N RTP1_C1 Arm HEAT_EZ APH Pkinase_fungal Cohesin_HEAT HTH_15 Haspin_kinase Kdo Choline_kinase
Motif
Other DBs
NCBI-ProteinID: ANB01386
UniProt: A0A161HW40
LinkDB All DBs
Position
complement(470584..473016)
Genome map
AA seq 810 aa AA seqDB search
MSVFSDFRAERQIQRLLEAADLDEAEAQKRLNKLRSLGEAGVRRLLHGLADASGDGLSRT
MELLRRLVNDATLPVFLQALADINQTRVDRVAQVLEGASGFDPSPLARAFRDPAVSKSAL
VRVLHAHRHRLNASLLLREAYDLQPVDRNALFRVVDEVADESVLPDLVSRASGKDPVIRR
MVVRVLRRFDTPQVRAILQERLSDEDKGVRGAALEALMAMGAVDMDAASLCTLLHDPDIN
VQHKAIDAIIQLDDPHIMRHLLPVLQDDSEYVRRAAVEVLNGVGNASNIKELLVSIKDED
WWVRARSADALAQIGGPRVVRAVVELIRDEDEFVRRSAVEILNSTRDETALTYLIDALED
SDWWVRERAVDALGSIGNASAVPALLKMLDRDADAAPVVVRNLARLQDDRAVEPLMRHLA
GNDRSVRLEAVNALVELADARTAPEVLRAIQQHTADADGELQDMARDASARLEARFAISS
LGQGVSGQALPEATSILDGDTGQMALTLGGADETAAGTRRLSAHGGGLNLETLRPGEMLG
ERYRFIRRVGKGAFGTVLLMDDVMISETIILKVMNPQLAADEEMIKRFVQELRLSRKITH
ENVIRIYDFLTVQGVLAISMEYFPSSTLGVVLKQERPMPQDRAVGFAACIASGIGAAHEV
GVIHRDLKPGNVLINNREQVKIVDFGIASVTGSADTRLTRTGILIGTPKYMAPEQVTGRK
ITHSADIYALGVMLYEMITGEVPYSGEDQMAIMYQHVQGQATPPHEMNPQIDRELSAIVM
TMMAVDPGDRFPTMRDVRKTLLEFQQERRV
NT seq 2433 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtgttcagcgattttcgtgccgaacgccagatccagcgcctgctggaggcggcg
gatctggacgaggcggaagcgcaaaagcgcctgaacaagctgaggtccctgggggaagcc
ggtgtgcggcgcctgctgcatgggctggccgatgcctcgggtgacggtctgtcccgcacc
atggaactgctgcggcgcctggtgaacgatgcaaccctgccggtcttcctgcaggccctg
gccgacatcaatcagacccgggtggaccgggttgcccaggtgcttgagggcgccagtggg
ttcgaccccagtcccctggcccgtgcctttcgtgaccccgccgtgtccaaatcggccctg
gtgcgggtgctgcatgcccaccggcaccggctcaatgccagcctgctgttgcgcgaggcg
tatgacctgcagccggtggaccgcaatgccctgttccgcgtggtggacgaggtggccgac
gagtcagtgctccccgacctggtgagtcgggcctccgggaaggatccggtgatccggcgc
atggtggtcagggtgctgcgacgctttgatacccctcaggtgcgcgccatcctgcaggaa
cggctcagtgacgaggacaagggggtgcgcggcgccgccctggaggcgctgatggccatg
ggggcggtggacatggatgccgcctccctgtgcaccctgctgcatgatccggacatcaac
gtgcagcacaaggccatcgacgccatcatccagctggacgacccccacatcatgcgtcac
ttattgccggtgctgcaggatgactcggagtatgtacgccgggccgccgtggaggtgctc
aatggtgtgggtaacgccagcaacatcaaggaactgctggtttccatcaaggatgaggac
tggtgggtgcgagcccgttccgccgatgccctggcgcagattggtgggccccgggtggtg
cgggcagtggtggaactgatccgtgacgaggatgagttcgtgcgccgctcggcggtggag
atcctcaattccacccgtgacgagacggccctgacctatctcattgatgcccttgaggac
tctgactggtgggtgcgggagcgcgccgtggatgccctgggtagtatcggcaacgcctcg
gcggtgccggccttgctgaagatgctggatcgggacgccgatgcggccccggtggtggtg
cgtaacctggcccgtctgcaggatgaccgggcggtggagcccttgatgcggcatctggca
ggcaatgatcgttcggtgcgcctggaagcggtgaatgccctggtggaactggccgatgcc
cgcacggctcccgaagttctcagggccatccagcaacacacggcggatgccgacggtgag
ttgcaggacatggcgcgggatgccagtgcccggctggaggcccggtttgccatttcttcg
ctggggcagggggtctccggccaggccctgcctgaagccacctccattctggatggcgat
acaggacagatggccctcaccctgggcggcgcagacgagaccgcggcgggcacccgtcgc
ctgagcgcccatggtggcggcttgaacctggagaccctcaggccgggggaaatgctggga
gagcgctaccgcttcatccgccgtgtgggcaaaggggcctttggcaccgtgctgctcatg
gacgatgtgatgatctccgagaccatcatcctcaaggtcatgaacccgcagctggctgcc
gatgaagagatgatcaagcgcttcgttcaggaactgcgcctgtcccgcaagatcacccac
gagaacgtgatccgcatctacgatttcctgacggtgcagggggtgctggccatctccatg
gagtatttcccgtcatccaccctgggtgtggtcctcaagcaggagcgccccatgccccag
gacagggccgtggggttcgccgcctgcattgcatccggcatcggtgctgcccacgaggtg
ggcgtcatccatcgggatctcaagccgggcaatgtgctcatcaacaacagggaacaggtc
aagatcgtggacttcggtatcgcctcggtgaccggttcggcggacacccgcctcacccgc
accggtatcctcatcggcacccccaaatacatggccccggagcaggtgaccggccgcaag
atcacccacagcgccgacatctatgccctgggggtgatgctttacgagatgatcaccggt
gaggtgccctatagcggtgaggaccagatggccatcatgtatcagcatgtgcagggacag
gcgacaccgccccatgagatgaacccgcagatagaccgcgagctcagtgccatcgtcatg
acgatgatggcggtggaccccggggaccgcttccccaccatgcgggatgtgcgcaagact
ctgctagagttccagcaagagcggcgggtctga

DBGET integrated database retrieval system