KEGG   Ectothiorhodospira sp. BSL-9: ECTOBSL9_2191Help
Entry
ECTOBSL9_2191     CDS       T04374                                 

Definition
(GenBank) ribulose 1,5-bisphosphate carboxylase small subunit
  KO
K01602  ribulose-bisphosphate carboxylase small chain [EC:4.1.1.39]
Organism
ebs  Ectothiorhodospira sp. BSL-9
Pathway
ebs00630  Glyoxylate and dicarboxylate metabolism
ebs01100  Metabolic pathways
ebs01120  Microbial metabolism in diverse environments
ebs01200  Carbon metabolism
Module
ebs_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
Brite
KEGG Orthology (KO) [BR:ebs00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ECTOBSL9_2191
Enzymes [BR:ebs01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     ECTOBSL9_2191
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_small
Motif
Other DBs
NCBI-ProteinID: ANB02730
UniProt: A0A167AXU9
LinkDB All DBs
Position
complement(2331071..2331400)
Genome map
AA seq 109 aa AA seqDB search
MSDIQSFKSSQKYETFSYLPQMNAEQIRQQIQYLVDQGWNPAIEHSEPENAFGSYWYMWK
LPMFGEQSVDTVLAEVEACKQENPGHLVRLIGYDNYAQCQGTSMLVHKG
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatatccagagcttcaagtcgtcgcagaaatacgagaccttctcctacctgccg
cagatgaacgccgagcagatccgccagcagatccagtatctggtggaccagggctggaac
ccggccatcgagcacagcgagcccgagaacgccttcggttcctactggtacatgtggaag
ctgcccatgttcggtgagcagtcggtggacaccgtcctggccgaagtggaggcctgcaag
caggagaacccgggtcacctggtgcggttgatcggttacgacaactacgcccagtgccag
ggcacctccatgctggtgcacaagggctga

DBGET integrated database retrieval system