KEGG   Shimwellia blattae: EBL_c00860Help
Entry
EBL_c00860        CDS       T02111                                 

Gene name
sodA
Definition
(GenBank) Mn dependent superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ebt  Shimwellia blattae
Brite
Enzymes [BR:ebt01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     EBL_c00860 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AFJ45222
UniProt: I2B3W8
LinkDB All DBs
Position
90835..91461
Genome map
AA seq 208 aa AA seqDB search
MIMSYTLPSLPYAYDALEPHFDKQTMEIHHSKHHQAYVNNANAALESLPEFASLPVEELI
TKLDQLPADKKTALRNNAGGHANHSLFWKGLKKGTTLQGDLKAAIERDFGSVDAFKAEFE
KAAATRFGSGWAWLVLKGDKLAVVSTANQDSPLMGEAISGASGFPIVGLDVWEHAYYLKF
QNRRPDYIKEFWNVVNWDEAAARFAAKK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgattatgagttatacactgccatccctgccgtacgcttatgacgcactggagccgcac
ttcgacaaacagaccatggaaatccaccacagcaagcaccaccaggcgtatgtgaataac
gctaacgctgcgctggaaagcctgccggagtttgccagcctgccggttgaggagctgatc
accaaactggatcaactgcctgcggataaaaaaaccgcgctgcgtaacaatgccggtggc
catgcgaaccacagcctgttctggaaggggctgaaaaaaggcaccacgctgcagggcgat
ctgaaagccgccattgagcgtgatttcggctctgtcgatgccttcaaagcagagtttgaa
aaagccgctgccacccgttttggttccggctgggcgtggctggtgctgaaaggcgataag
ctggcagtggtctccacggctaaccaggacagcccgctgatgggtgaagccatttctggt
gcttccggcttcccgattgttggcctggatgtctgggagcatgcttactacctgaaattc
cagaaccgccgcccggactacattaaagagttctggaacgtggtgaactgggatgaagct
gcagcccgttttgctgctaaaaaataa

DBGET integrated database retrieval system