KEGG   Shimwellia blattae: EBL_c09650Help
Entry
EBL_c09650        CDS       T02111                                 

Gene name
pheA
Definition
(GenBank) bifunctional chorismate mutase P and prephenate dehydratase
  KO
K14170  chorismate mutase / prephenate dehydratase [EC:5.4.99.5 4.2.1.51]
Organism
ebt  Shimwellia blattae
Pathway
ebt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ebt01100  Metabolic pathways
ebt01110  Biosynthesis of secondary metabolites
ebt01130  Biosynthesis of antibiotics
ebt01230  Biosynthesis of amino acids
Module
ebt_M00024  Phenylalanine biosynthesis, chorismate => phenylalanine
ebt_M00025  Tyrosine biosynthesis, chorismate => tyrosine
Brite
KEGG Orthology (KO) [BR:ebt00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    EBL_c09650 (pheA)
Enzymes [BR:ebt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.51  prephenate dehydratase
     EBL_c09650 (pheA)
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.5  chorismate mutase
     EBL_c09650 (pheA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PDT CM_2
Motif
Other DBs
NCBI-ProteinID: AFJ46080
UniProt: I2B6C6
LinkDB All DBs
Position
complement(983492..984655)
Genome map
AA seq 387 aa AA seqDB search
MTAENPLLDLRDKISALDAQLLELLGKRRQLAVEVGKAKLASHRPVRDIDREKDLLERLI
ALGKAHHLDAHYITRLFQLIIEDSVLTQQALLQQHLNQTNPASARVAFLGPKGSYSHLAA
RQYAARHFEQFQESGCTRFSDIFSQVETGQADYAVVPIENTSSGAINDVYDLLQHTSLAI
VGEMTVPIDHCVLVATTTALDQIETIYSHPQPFQQCSHFIARYPHWKIEYCESTSAAMEK
VKQANSPRVAALGSEAGGALYGLQVLERNLANQTQNITRFLVLARKAVNVSDQVPAKTTL
LMATGQQAGSLVEALLVLRNHNLIMTKLESRPINGNPWEEMFYLDIQANVQDAAMQQALR
EMTETARSLKVLGCYPSENVVPVDPAR
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgacagcggaaaacccgttactggacttgcgagacaaaatcagcgccctggacgctcag
ttactggagctgctcggcaaacggcgccagctggccgtggaagtgggtaaggcaaaactg
gcatcccaccggcccgtgcgcgacatcgaccgggaaaaagacctcctggagcgcctgata
gcgctgggcaaagcccaccatcttgacgcccactacatcacccggctattccagttaatt
atcgaagactccgtactgacccagcaggcactgctgcaacagcatctgaaccagaccaac
cccgcctctgcccgggtggccttcctcggcccgaaaggctcttattcacaccttgcggcc
cgccagtacgcagcgcgccactttgagcagttccaggaaagcggctgtacgcgctttagt
gatatcttcagccaggtagagaccggccaggcagactacgccgtggtgccgattgaaaac
accagctccggggcgattaacgacgtatacgacctgctgcagcacacatcgctggccatc
gtgggtgaaatgacggtgcctatcgaccactgcgtgctggttgccaccactaccgccctc
gaccagatagagacgatttacagccacccgcagcccttccagcagtgcagccactttatt
gcccgctacccgcactggaagatcgaatactgcgaaagcacctccgccgcgatggaaaaa
gtcaaacaggcaaactcgccgcgggtggcggcactgggcagtgaagccggtggcgccctg
tatggcctgcaggtgctggagcgcaacctggcaaaccagacacagaatattacccgcttc
ctggtgctggcccgcaaggcggtgaatgtctcagaccaggttccggcaaaaaccaccctg
ctgatggcgaccggccagcaggcgggctcactggttgaagccctgctggtactgcgcaat
cacaacctgatcatgaccaaactggaatcacgcccgatcaacggtaacccgtgggaagag
atgttttatctggatattcaggccaacgtgcaggatgcggccatgcagcaggcgctgcgt
gaaatgaccgaaaccgcccgctcgctgaaagtgctgggatgctaccccagtgagaatgtg
gtgccggtagatccggcccggtaa

DBGET integrated database retrieval system