KEGG   Shimwellia blattae: EBL_c22740Help
Entry
EBL_c22740        CDS       T02111                                 

Gene name
gst
Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ebt  Shimwellia blattae
Pathway
ebt00480  Glutathione metabolism
ebt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ebt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    EBL_c22740 (gst)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ebt02000]
    EBL_c22740 (gst)
Enzymes [BR:ebt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     EBL_c22740 (gst)
Transporters [BR:ebt02000]
 Other transporters
  Pores ion channels [TC:1]
   EBL_c22740 (gst)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_N GST_N_3 GST_C_3 GST_N_2 GST_C_2 GST_C_6 Glutaredoxin2_C GST_N_4
Motif
Other DBs
NCBI-ProteinID: AFJ47365
UniProt: I2BA11
LinkDB All DBs
Position
2331099..2331704
Genome map
AA seq 201 aa AA seqDB search
MKLYYKSGACSLSPHIVLREAGLDFTLERVDLASKKTEAGEDYLHINPKGQVPALLLDSG
DMLTEGVAIVQYLADQVPDRNLIAPAGTLARYHAIESLNFIATELHKGFTPLFTPGVPDE
YKKIATERLLRHFAALDVLLGEQDYLQGARFSVADAYLFTVLGWAFMLKFDLSHLPALQR
YYQRIAARPAVRAALEAEGLK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtattacaaatcgggggcctgctcactttcaccccatattgttctgcgcgaa
gcggggctggactttacgctggagcgcgtagacctggcgagcaaaaaaaccgaagcgggt
gaagattacctgcacattaaccccaaaggccaggtgcctgccctgctgctggacagtggc
gacatgctcactgaaggggtggccattgttcagtacctggccgaccaggtgccggatcgc
aacctgatcgccccggcgggaaccctggcccgttaccacgctatcgaatcccttaatttc
atcgctaccgagctccacaaagggtttactccgctctttacgcccggtgtgccggatgag
tataaaaaaatcgccacagaacgtctgctgcgccatttcgccgcactggatgtgctactc
ggcgagcaggactacctgcagggtgcccgttttagcgtggcggatgcctatctgttcacg
gtactgggctgggcatttatgctgaagttcgatctcagccatctgccggcgctgcagcgc
tactaccagcggattgccgcccgcccggcagtcagggcagccctggaagccgaagggtta
aaataa

DBGET integrated database retrieval system