KEGG   Shimwellia blattae: EBL_c29420
Entry
EBL_c29420        CDS       T02111                                 

Gene name
ddlA
Definition
(GenBank) D-alanine--D-alanine ligase A
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ebt  Shimwellia blattae
Pathway
ebt00473  D-Alanine metabolism
ebt00550  Peptidoglycan biosynthesis
ebt01100  Metabolic pathways
ebt01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ebt00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    EBL_c29420 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    EBL_c29420 (ddlA)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    EBL_c29420 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ebt01011]
    EBL_c29420 (ddlA)
Enzymes [BR:ebt01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     EBL_c29420 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:ebt01011]
 Precursor biosynthesis
  Amino acid ligase
   EBL_c29420 (ddlA)
SSDB
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 RimK ATPgrasp_ST
Other DBs
NCBI-ProteinID: AFJ48012
UniProt: I2BBV8
LinkDB
Position
3030976..3032076
AA seq 366 aa
MAKLRVGIVFGGKSAEHEVSLQSAKNIVDAIDKTKFDVVLLGIDKQGQWHINDEHNYLLN
AADPARIALNHSGVNLAVTPGQQHGQLIDARAASPLPQLDVVFPIVHGTLGEDGSLQGML
RMANLPFVGSGVLGSAVSMDKDVAKRLLRDAGLNVAPFVTLTRSNRDKYHFAELAETLGV
PLFVKPANQGSSVGVSKVTTAAQYQEAVALAFRFDTKVVVEKGITGREIECAILGNDDPQ
ASTCGEIVINSDFYSYDTKYIDDKGAQVVVPADLPREINDKIRAIAIRAYQALECSGMSR
VDVFLTPENEVIINEINTLPGFTNISMYPKLWQASGIGYQALITRLIELAIERHQQESAL
LSSISE
NT seq 1101 nt   +upstreamnt  +downstreamnt
atggcaaaattacgtgtagggatcgtgtttggcggcaagtcggctgagcatgaagtctct
cttcagtcggctaaaaatatcgtcgacgcaattgataaaaccaaatttgatgtggtgctg
ctgggcattgataaacagggccagtggcacattaatgatgagcacaactacctgctcaac
gccgcagatccggcccgtatcgccctgaaccattccggggtcaacctggccgtgaccccg
ggccagcagcacgggcaactgatcgacgcccgggccgccagcccgctcccacagctggat
gtggtgttccccatcgtacacggcaccctcggggaagatggctccctgcagggcatgctg
cgcatggcgaatttaccttttgtcggttccggcgtgctgggctccgctgtcagcatggac
aaagacgtggccaaacgcctgctgcgtgatgcgggcctgaatgttgcccccttcgtgacg
ctgacccgcagcaaccgcgataaataccactttgccgaactggctgagacgctcggcgtg
ccgctgtttgtcaagccagccaaccagggctcgtctgtcggcgtcagcaaagtgaccact
gccgcccagtaccaggaggcggtggccctggcgttccgctttgacaccaaagtggtggtg
gaaaaagggatcaccggccgggagatcgagtgcgccatcctcgggaatgacgatccgcag
gccagtacctgtggtgaaattgtcattaacagtgatttttactcttacgatacaaaatat
atcgatgataaaggcgcccaggtggtggttccggccgatttgccccgcgagatcaacgac
aagatccgcgcgatcgccatccgcgcctatcaggcgctggagtgcagcggcatgtcccgg
gtggatgtgttcctgaccccggaaaatgaagttatcatcaatgaaatcaacacactgccc
gggtttaccaatatcagcatgtacccgaaactgtggcaggccagcggtattggctaccag
gcgctgattacccgcctgattgagctggccattgagcgccaccagcaggaaagcgcgctg
ctgagcagtatcagcgaataa

DBGET integrated database retrieval system