KEGG   Shimwellia blattae: EBL_c34190Help
Entry
EBL_c34190        CDS       T02111                                 

Gene name
sodC1
Definition
(GenBank) superoxide dismutase [Cu-Zn] precursor
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ebt  Shimwellia blattae
Brite
Enzymes [BR:ebt01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     EBL_c34190 (sodC1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AFJ48479
UniProt: I2BD75
LinkDB All DBs
Position
3533497..3534036
Genome map
AA seq 179 aa AA seqDB search
MKLRICARLAGALAAGLFAHAVQAATVSVPVYEALPTGQGKALGDVSITETPYGLLFTPQ
LKGLEPGVHGFHIHANPSCEPGEDQGKTVPALKAGGHLDPQNTGQHLGPYNDAGHSGDLP
GLVVTADGDARYPVLAPKLKKLDEVKNHALMVHVGGDNYADHPAKLGGGGVRFACGVIH
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttcgcatctgtgcccgtctggctggcgcgctggcggcggggctgtttgcccac
gctgtgcaggccgccacggtcagcgttccggtttatgaggccctgcccaccggccagggc
aaagcgctgggtgatgtcagtatcaccgaaaccccttacgggttactcttcaccccgcag
ctaaaagggctggagccgggggtacacggctttcatatccacgctaaccccagttgtgaa
ccgggtgaagatcagggtaaaaccgttccggccctgaaggcgggcggccatcttgacccg
caaaataccggccagcatctgggcccctataacgatgccgggcacagcggggatctgccc
ggcctggtggtcaccgctgacggcgacgcccgttatccggtactggccccgaagctgaaa
aagctcgacgaggtcaaaaaccatgcgttgatggtccatgtgggcggggataactatgcg
gatcacccggcgaaacttggcggcggcggcgtgcgctttgcctgcggggttattcactag

DBGET integrated database retrieval system