KEGG   Shimwellia blattae: EBL_c39590Help
Entry
EBL_c39590        CDS       T02111                                 

Gene name
rbsA
Definition
(GenBank) high affinity ribose transport ATP-binding protein RbsA
  KO
K10441  ribose transport system ATP-binding protein [EC:7.5.2.7]
Organism
ebt  Shimwellia blattae
Pathway
ebt02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ebt00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    EBL_c39590 (rbsA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ebt02000]
    EBL_c39590 (rbsA)
Enzymes [BR:ebt01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.7  ABC-type D-ribose transporter
     EBL_c39590 (rbsA)
Transporters [BR:ebt02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Ribose transporter
    EBL_c39590 (rbsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_30 RsgA_GTPase ABC_ATPase AAA_22 Ploopntkinase3 AAA_29 AAA_15 AAA_23 MMR_HSR1 MukB
Motif
Other DBs
NCBI-ProteinID: AFJ48983
UniProt: I2BEM9
LinkDB All DBs
Position
complement(4098375..4099895)
Genome map
AA seq 506 aa AA seqDB search
MVMDALLQLKGIDKSFPGVKALSGAALNVYPGRVMALVGENGAGKSTMMKVLTGIYTRDA
GSLLWLGKETTFNGPKASQEAGIGIIHQELNLIPELTVAENIFLGREFVSRFGRIDWKKM
RAEADKLLAKLNLRFDSQVLVGSLSIGDQQMVEIAKVLSFESKVIIMDEPTDALTDTETD
SLFRVIRELKAQGRGIVYISHRMKEIFEICDDVTVFRDGQFIAEREVASLTEDSLIEMMV
GRKLEDQYPHIKHQSGEVRLRVDNLSGPGVHNVSFTLHAGEILGVSGLMGAGRTELMKVL
YGALPRTGGYVALDGREVVTRTPQDGLANGIVYISEDRKRDGLVLGMSVKENMSLTALRY
FCRAGGGLKHSDEQQAVQDYIRLFNVKTPSMDQTIGLLSGGNQQKVAIARGLMTRPKVLI
LDEPTRGVDVGAKKEIYQLINQFKSDGLSIILVSSEMPEVLGMSDRIIVMHEGRLGGEFT
REQATQEVLMAAAVGKLNRENQEQQA
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atggttatggacgcattattacaactaaaagggatcgataaatcgttcccgggcgttaag
gctctttccggcgctgcgctcaatgtctaccccgggcgggtgatggcgctggtgggtgaa
aacggcgccggtaaatccaccatgatgaaagtgctgaccgggatttacacccgcgatgca
ggttcactgctgtggcttggcaaagagaccaccttcaacgggccaaaagcctctcaggaa
gcggggatcgggattatccatcaggaacttaacctgatcccggagctgacagtggcggaa
aatatcttcctggggcgtgaatttgtcagccgctttgggcgtatcgactggaaaaagatg
cgtgccgaagccgataaattgctggcgaaacttaacttacgttttgacagccaggtactg
gtcggctctctgtccattggcgaccagcaaatggttgaaatcgcgaaagtgctgagcttt
gagtcgaaggtcatcattatggatgaaccgacagacgcactgaccgacaccgaaaccgac
tctctgtttcgggtgattcgtgagcttaaagcgcagggacgcggtattgtttatatctct
caccgtatgaaagagattttcgagatctgcgatgatgtcaccgtatttcgcgacgggcag
ttcattgccgagcgtgaagtggcaagccttacggaagacagcctgatcgaaatgatggtc
ggccgtaagctcgaagatcagtacccccatattaaacaccagtccggagaggtgcgcctg
cgggtggataacctttccgggccgggcgtccataacgtgagctttaccctgcatgccggg
gagatcctcggggtttccgggctgatgggggccgggcgcacagagctgatgaaagtgctg
tacggcgcgctgccgcgcaccggtggctatgtggcgctggatggccgtgaagtggtcacc
cgcaccccgcaggatggcctggcaaacggcattgtgtatatctcggaagaccgtaagcgc
gacgggctggtactgggcatgtcagtaaaagagaacatgtccctgaccgcgttgcgctat
ttctgccgcgccggtggcgggctgaaacacagcgacgagcagcaggccgttcaggactat
atccggctgtttaatgtcaaaaccccttctatggatcagaccattggcctgttatccggc
ggtaaccagcagaaagtggcgattgcccggggcttaatgacccgcccgaaagtgcttatc
ctcgatgagccgacccgcggtgtggatgtcggggcaaaaaaagagatctatcagttaatc
aaccagtttaaatcagacggcctgagcatcattctggtttccagcgaaatgccggaagtg
ctcggcatgagtgaccggataatcgtgatgcacgaagggcggctcggcggggaattcacc
cgcgagcaggccactcaggaagtattgatggccgcagccgtcggcaagctaaaccgcgag
aatcaggagcaacaagcatga

DBGET integrated database retrieval system