KEGG   Enterobacteriaceae bacterium S05: CUC76_06300Help
Entry
CUC76_06300       CDS       T05725                                 

Definition
(GenBank) cyclic diguanylate phosphodiesterase
Organism
ebu  Enterobacteriaceae bacterium S05
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EAL CSS-motif Metal_resist DUF3301
Motif
Other DBs
NCBI-ProteinID: AWB61245
UniProt: A0A2S0VAN3
LinkDB All DBs
Position
1236963..1238498
Genome map
AA seq 511 aa AA seqDB search
MKEIKRRNAWIAFSLALVVFLAGVFVINWQLWHSDQASHVATARQAAKKIAVILDEARAA
TMTAMNVSRGGCSVQGQFQLGTEAALQPHLRTIVLVKQGQVWCSSLPGNRVLMLHPESLP
DEPLQLMPARMMVNKRPVLIYHTRSAQVRVIVSISDIHLRDALYSDEDNGGLALLVHNQM
IARYGDVKPLNAGPNHDIFSSPDYPFHIAYPESPFFSPSRLFHNGSGLLIFIFSVSLLFY
FLLRKYLNVYTSEEERLRYAIAQGAIVPYYQPLVNGKTGEIYGVEILARWPNTTAQWRSP
AEFIPLAERTGLIIPLTCSLMAQVAAQMRPIFSKLPDGFHIGVNISASHINAPSFIDDCL
HFQRGFEGTAVKLMLEITEQEPLLLNEAVVDKLNALHSRGFSIALDDFGTGYSGLSYLHE
LVFDYIKIDQSFVGRVTDEAPSSKLLDCVIEMARTLSLRIIAEGVETQAQLEYLNRQNIH
LLQGYFFWKPMPYVALVMLLLSKPKARIIEE
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagataaagcgacgaaacgcatggattgccttttccctggcgctggtggtattt
ctggctggcgtgttcgtaataaactggcaactgtggcattccgatcaggcctcgcatgtc
gccaccgcccgtcaggcggcaaagaaaatcgccgttattctggatgaggcccgcgcagca
acgatgacggcgatgaacgttagccgcggcggttgctccgtgcagggccagtttcagctc
gggaccgaggccgccctgcagccgcatctgcgcacaattgtgctggtaaaacagggccag
gtgtggtgctcgtcgctgccgggcaatcgggtactgatgctccaccctgagtctttaccc
gatgagccactgcaactgatgcccgccagaatgatggtgaataagcggccagtgctgatc
tatcacactcgttcggcgcaggtaagagtcattgtcagcatcagcgatatccatttgcgc
gatgccttgtatagcgatgaggataacggcgggctggcgcttttggttcacaatcaaatg
attgccagatatggcgatgtgaagccactcaacgctggtccgaaccatgatatttttagc
tcaccagactatccatttcacattgcctatcctgagtcgcctttttttagccccagccgc
ttatttcataatgggtccgggctgctgatttttattttctctgtttcgttgctgttttat
tttctgttgcgcaaatacctcaatgtctatacctcagaagaggagaggctgcgctacgcc
atcgctcagggcgctatcgttccctactatcaaccgctggtgaacgggaaaaccggagag
atctatggcgtggaaatccttgcccgctggccaaacaccacggcgcagtggcgttcgccc
gctgaatttattccgctggccgagcgtaccggcttgattatcccactcacttgtagcctg
atggcgcaggtcgccgcccagatgaggccgatcttcagtaagctgccggacgggtttcat
atcggcgtcaatatcagcgcatcacatatcaacgccccgtcgtttatcgatgactgcctg
cactttcagcgcggctttgagggcacagcggtgaagctgatgctggagatcaccgaacag
gagccgctgttgctcaacgaggcggttgtcgacaagctcaacgcattacactcccgcggg
ttttccatcgcgctggacgactttggcaccggctattccgggctttcctatctgcatgag
ctggttttcgactatatcaaaatcgatcagagctttgtcggccgggtgactgacgaggcg
ccgtcaagcaaactgctggactgcgtgatagagatggcgcggacgttgtcactgcgcatc
attgccgagggggtcgaaactcaggctcagctagagtatctcaatcgccagaatattcat
ctgttgcagggctactttttctggaagccgatgccctacgtcgcgctggtgatgcttctg
ctgagcaaaccaaaggcgcggattatcgaagaatga

DBGET integrated database retrieval system