KEGG   Enterobacteriaceae bacterium S05: CUC76_10320Help
Entry
CUC76_10320       CDS       T05725                                 

Definition
(GenBank) aspartate aminotransferase family protein
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
ebu  Enterobacteriaceae bacterium S05
Pathway
ebu00250  Alanine, aspartate and glutamate metabolism
ebu00280  Valine, leucine and isoleucine degradation
ebu00310  Lysine degradation
ebu00410  beta-Alanine metabolism
ebu00640  Propanoate metabolism
ebu00650  Butanoate metabolism
ebu01100  Metabolic pathways
ebu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ebu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CUC76_10320
   00650 Butanoate metabolism
    CUC76_10320
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CUC76_10320
   00280 Valine, leucine and isoleucine degradation
    CUC76_10320
   00310 Lysine degradation
    CUC76_10320
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CUC76_10320
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ebu01007]
    CUC76_10320
Enzymes [BR:ebu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CUC76_10320
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     CUC76_10320
    2.6.1.48  5-aminovalerate transaminase
     CUC76_10320
Amino acid related enzymes [BR:ebu01007]
 Aminotransferase (transaminase)
  Class III
   CUC76_10320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: AWB61960
UniProt: A0A2S0VCW6
LinkDB All DBs
Position
2065841..2067124
Genome map
AA seq 427 aa AA seqDB search
MNSNKALMARRSDAVPRGVGQIHPIFAERAENCRVWDVEGREYLDFAGGIAVLNTGHLHP
QIVAAVEDQLKKLSHTCFQVLAYEPYLALCEKMNQKVPGDFAKKTLLVTTGSEAVENAVK
IARAATGRSGAIAFTGAYHGRTHYTLSLTGKVNPYSAGMGLMPGHVYRALYPCALHGVSD
DEAIASIHRIFKNDAAPEDIAAIIIEPVQGEGGFYAASPAFMQRLRALCDEHGIMLIADE
VQSGAGRTGTLFAMEQMGVAADITTFAKSIAGGFPLAGVTGRAEVMDAIAPGGLGGTYAG
NPIACAAALAVLQIFEQENLLEKANQLGDTLRQGLLAIAEEHPEIGDVRGLGAMIAIELF
EEGDHSRPNARLTADIVARARDKGLILLSCGPYYNVLRILVPLTIEEAQIEQGLKIIADC
FTEAKQA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgaacagcaataaagcattaatggcgcgtcgcagcgacgcggtcccgcgcggcgtcggc
cagatccatcctatcttcgccgagcgcgcggagaactgccgggtgtgggacgtcgaaggg
cgggaatatctcgatttcgccggcggtatcgcggtgctcaataccggccacctgcatccg
cagattgtcgccgccgtggaggaccagctgaaaaagctgtcccatacctgcttccaggtg
ctggcctacgagccctacctggcgctgtgcgaaaagatgaaccagaaggtgccaggtgat
ttcgccaagaaaaccctgctggtcaccaccgggtcggaagcggtggagaacgcggtgaag
atcgcccgcgcggcaaccgggcgcagcggcgctatcgccttcaccggcgcctatcacggc
cgtacccattacaccctgtcgctgaccggcaaagtgaacccttactccgccggtatgggc
ttaatgccgggccacgtctatcgcgccctctacccgtgcgcgctgcacggcgtcagcgat
gacgaggcgatcgccagcatccatcgcatcttcaaaaacgatgccgcgccggaagatatc
gccgccatcattatcgagccggtgcagggtgaaggcggattctatgccgcctccccggcc
tttatgcagcgcctgcgcgccctgtgcgacgagcacggcattatgctcatcgccgatgag
gttcagagcggcgcgggccgcaccggtaccctgttcgccatggagcagatgggcgtcgcg
gcggatatcaccaccttcgccaaatccatcgccggcggtttcccgctggcgggcgtcacc
ggccgcgcggaggtgatggacgccatcgccccgggcggactgggcggcacctacgctggc
aaccccatcgcctgcgccgccgccctggcggtattgcagattttcgagcaggaaaatctg
ctggaaaaagccaaccagctcggcgataccctgcgccagggcctgctggcgatcgctgaa
gagcatccggagatcggcgatgtccgcggtctgggagcgatgatcgccatcgagctgttt
gaagagggcgaccacagcagaccgaacgcaagactcacggcggatatcgtcgcccgcgcg
cgcgacaaaggcctgatcctgctctcctgcgggccgtactacaacgtactgcgcatcctg
gtgccactgaccatcgaagaggcgcagatcgagcaggggctgaagatcatcgccgactgc
tttaccgaggcgaaacaggcatag

DBGET integrated database retrieval system