KEGG   Enterobacteriaceae bacterium S05: CUC76_10645Help
Entry
CUC76_10645       CDS       T05725                                 

Gene name
fabZ
Definition
(GenBank) beta-hydroxyacyl-ACP dehydratase
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
ebu  Enterobacteriaceae bacterium S05
Pathway
ebu00061  Fatty acid biosynthesis
ebu00780  Biotin metabolism
ebu01100  Metabolic pathways
ebu01212  Fatty acid metabolism
Module
ebu_M00083  Fatty acid biosynthesis, elongation
ebu_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:ebu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CUC76_10645 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CUC76_10645 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:ebu01004]
    CUC76_10645 (fabZ)
Enzymes [BR:ebu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     CUC76_10645 (fabZ)
Lipid biosynthesis proteins [BR:ebu01004]
 Fatty acid synthase
  Component type
   CUC76_10645 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT PS-DH
Motif
Other DBs
NCBI-ProteinID: AWB62009
UniProt: A0A2S0VCQ7
LinkDB All DBs
Position
complement(2126982..2127437)
Genome map
AA seq 151 aa AA seqDB search
MTTDTHTLHIEEILELLPHRYPFLLVDRVLDFEEGRFLRAVKNVSVNEPFFQGHFPGKPI
LPGVLILEAMAQATGILAFKSVGKLEPGELYYFAGIDEARFKRPVVPGDQMIMEVTFEKT
RRGLTRFKGVALVDGKVVCEATMMCARSREA
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
ttgactactgacactcatactctgcacattgaagagattctggaacttctgcctcaccgt
tacccgttcctgctggtagatcgcgtgctggattttgaagaaggtcgttttctgcgcgca
gtaaaaaatgtttctgtaaacgagccgtttttccaggggcatttccctggtaagccgatt
ttgccgggcgtcctgattctggaagcaatggcgcaggccaccgggattctggcattcaaa
agcgttggaaaactggaaccaggcgagctgtattacttcgcgggcatcgatgaagcacgt
ttcaaacgcccggtagtaccaggcgatcagatgattatggaagtcactttcgagaaaacc
cgccgcggcctgacccgtttcaaaggcgttgcgctggttgacggtaaagtggtttgcgaa
gcgacgatgatgtgtgcgcgtagccgggaggcctga

DBGET integrated database retrieval system