Enterobacteriaceae bacterium S05: CUC76_13210 Help Entry CUC76_13210       CDS       T05725                                  Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism ebu  Enterobacteriaceae bacterium S05 Pathway ebu02024   Quorum sensing ebu03018   RNA degradation Brite KEGG Orthology (KO) [BR:ebu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     CUC76_13210  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     CUC76_13210  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:ebu03019]     CUC76_13210    03036 Chromosome and associated proteins [BR:ebu03036]     CUC76_13210 Messenger RNA biogenesis [BR:ebu03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      CUC76_13210 Chromosome and associated proteins [BR:ebu03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     CUC76_13210 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Motif Other DBs NCBI-ProteinID:  AWB62484 LinkDB All DBs Position complement(2653150..2653458) Genome browser AA seq 102 aa AA seqDB search MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS TVVPSRPVSHHSNNAGGGSSNYHHGGSAQSSSAPQQDSDDAE NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatctttacaagatccgttcctgaacgctttgcgtcgggaacgcgtt ccggtttctatttatttggtgaatggtatcaagctgcaagggcaaattgagtctttcgat cagttcgtgatcctgttgaagaacacggtcagccagatggtctataagcacgcaatttct actgttgtcccgtctcgcccggtgtctcaccacagcaacaatgctggcggcggttccagt aactatcaccacggtggtagcgcgcagagctcttctgcgccgcaacaagacagcgacgac gccgaataa

DBGET integrated database retrieval system