KEGG   Enterobacteriaceae bacterium S05: CUC76_17140Help
Entry
CUC76_17140       CDS       T05725                                 

Definition
(GenBank) aspartate aminotransferase family protein
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
ebu  Enterobacteriaceae bacterium S05
Pathway
ebu00250  Alanine, aspartate and glutamate metabolism
ebu00410  beta-Alanine metabolism
ebu00640  Propanoate metabolism
ebu00650  Butanoate metabolism
ebu01100  Metabolic pathways
ebu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ebu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CUC76_17140
   00650 Butanoate metabolism
    CUC76_17140
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CUC76_17140
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CUC76_17140
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ebu01007]
    CUC76_17140
Enzymes [BR:ebu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CUC76_17140
Amino acid related enzymes [BR:ebu01007]
 Aminotransferase (transaminase)
  Class III
   CUC76_17140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AWB63179
UniProt: A0A2S0VG43
LinkDB All DBs
Position
3452920..3454185
Genome map
AA seq 421 aa AA seqDB search
MKSSELNQRRQQATPRGVGVMCNYFVEKAENATLWDIEGNEVIDFAAGIAVLNTGHRHPK
VVAAVADQLQAFTHTAYQIVPYESYVTLAERINDLAPIDGPAKTAFFTTGAEAVENAVKI
ARAYTGRPGLITFGGGFHGRTFMTMALTGKVAPYKIGFGPFPGSVYHGVYPNAAHGVTTA
DALKSLERIFKADIAPDQVAAIILEPIQGEGGFNVAPADFMQALRDLCDTHGILLIADEV
QTGFARTGKLFAMQHYDVKPDLMTMAKSLAGGFPLSGVVGRAEVMDAPAPGGLGGTYAGN
PLAVAAAHAVLDVIAEEQLCQRAEQLGSHLQEVLNQARATCPAIVDVRGRGSMVAVEFND
PQTGEPSPEFTRQVQQKAQENGLLLLSCGVYGNVIRFLYPLTIPDAQFSKALDILARVLK
S
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagctcagaactgaatcaacgtcgccagcaggcgacgccgcgcggcgtaggcgta
atgtgtaactactttgtcgagaaggcggagaacgccacgctgtgggatatcgaaggcaat
gaggtgatcgatttcgccgccggtatcgccgtgttaaataccggtcaccgtcatccgaag
gtggttgccgcggtcgctgaccagctgcaggcgttcacccacaccgcctatcagattgtg
ccgtacgaaagctatgtcacgctggctgaacgtatcaacgatctggcgccgattgacggg
ccggcaaaaacggccttcttcaccaccggcgcggaagcggtcgagaacgcggtgaaaatt
gcccgcgcttacaccggtcgtccggggctgataactttcggcggcggtttccacggccgt
acctttatgaccatggccctcaccggtaaggtcgcaccctacaaaatcggcttcgggccg
ttcccgggctcggtgtatcacggtgtctacccgaatgcggcgcatggcgtgaccacagcg
gatgcgctgaaaagcctggagcgcattttcaaagcggatattgcgccggatcaggtcgcg
gccatcatcctcgagccgatccagggggaagggggctttaacgtcgcgccggccgatttc
atgcaggcgctgcgcgacctgtgcgatacccacggcattctgctgatcgccgatgaagtg
cagaccggtttcgctcgtaccggcaagctgttcgccatgcagcattatgatgtgaaaccg
gatctgatgacgatggcgaaaagcctcgccggcggtttcccgctgtcgggcgtcgttggt
cgcgccgaggtaatggatgccccagcgccaggcggactgggcgggacctatgccggtaac
ccgctggcggtggccgcggcgcacgcggtgctggatgtgattgccgaagagcagctgtgc
cagcgcgctgagcagctgggtagccatctgcaggaagtgctcaaccaggcgcgcgccacc
tgtccggcgattgtcgatgtccgcggccgggggtcgatggtggcagtggagtttaacgat
ccgcaaactggcgagccgtcgccggagttcacccgccaggtgcaacagaaagcgcaggag
aacggcctgctgctgctgagctgcggcgtctacggcaacgtgatccgcttcctctatccg
ctgacgattccggacgcccagttctcgaaagcgctggatattctggcgcgcgtactgaag
agctaa

DBGET integrated database retrieval system