KEGG   Enterobacteriaceae bacterium S05: CUC76_24475Help
Entry
CUC76_24475       CDS       T05725                                 

Definition
(GenBank) DUF2492 domain-containing protein
Organism
ebu  Enterobacteriaceae bacterium S05
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2492 HTH_33 Transglut_core
Motif
Other DBs
NCBI-ProteinID: AWB64495
UniProt: A0A2S0VJZ7
LinkDB All DBs
Position
4920130..4920369
Genome map
AA seq 79 aa AA seqDB search
MSSIHGHEVLQMMLASGECWTAASLEAAIHRRFGAEARFHTCSAENLSAAELVAFLEQKG
KFIARATGFTTAENKICQH
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctattcatggtcatgaagtgctgcagatgatgctggcgtcgggggagtgctgg
acggcagcttcgctggaggcggccattcaccgtcgctttggcgcagaggcgcgctttcat
acctgttcggcggaaaatctgagcgctgcggagctggtggcgtttttagagcaaaaaggt
aaatttattgccagagcgacagggtttaccaccgcagaaaataagatttgccagcattaa

DBGET integrated database retrieval system