KEGG   Escherichia coli BW2952: BWG_0582Help
Entry
BWG_0582          CDS       T00913                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase, flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
ebw  Escherichia coli BW2952
Pathway
ebw00020  Citrate cycle (TCA cycle)
ebw00190  Oxidative phosphorylation
ebw00650  Butanoate metabolism
ebw01100  Metabolic pathways
ebw01110  Biosynthesis of secondary metabolites
ebw01120  Microbial metabolism in diverse environments
ebw01130  Biosynthesis of antibiotics
ebw01200  Carbon metabolism
Module
ebw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ebw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ebw_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ebw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BWG_0582 (sdhA)
   00650 Butanoate metabolism
    BWG_0582 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BWG_0582 (sdhA)
Enzymes [BR:ebw01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BWG_0582 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     BWG_0582 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like DAO Thi4
Motif
Other DBs
NCBI-ProteinID: ACR65585
LinkDB All DBs
Structure
PDB: 

Position
657890..659656
Genome map
AA seq 588 aa AA seqDB search
MKLPVREFDAVVIGAGGAGMRAALQISQSGQTCALLSKVFPTRSHTVSAQGGITVALGNT
HEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAILELEHMGLPFSRLDDGRIYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHTLYQQNLKNHTTIFSEWYALDLVKNQDGAVVGC
TALCIETGEVVYFKARATVLATGGAGRIYQSTTNAHINTGDGVGMAIRAGVPVQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKHGERFMERYAPNAKDLAGRDVVARSIMIEIREG
RGCDGPWGPHAKLKLDHLGKEVLESRLPGILELSRTFAHVDPVKEPIPVIPTCHYMMGGI
PTKVTGQALTVNEKGEDVVVPGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAAGLHLQ
ESIAEQGALRDASESDVEASLDRLNRWNNNRNGEDPVAIRKALQECMQHNFSVFREGDAM
AKGLEQLKVIRERLKNARLDDTSSEFNTQRVECLELDNLMETAYATAVSANFRTESRGAH
SRFDFPDRDDENWLCHSLYLPESESMTRRSVNMEPKLRPAFPPKIRTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgccagtcagagaatttgatgcagttgtgattggtgccggtggcgcaggtatg
cgcgcggcgctgcaaatttcccagagcggccagacctgtgcgctgctctctaaagtcttc
ccgacccgttcccataccgtttctgcgcaaggcggcattaccgttgcgctgggtaatacc
catgaagataactgggaatggcatatgtacgacaccgtgaaagggtcggactatatcggt
gaccaggacgcgattgaatatatgtgtaaaaccgggccggaagcgattctggaactcgaa
cacatgggcctgccgttctcgcgtctcgatgatggtcgtatctatcaacgtccgtttggc
ggtcagtcgaaaaacttcggcggcgagcaggcggcacgcactgcggcagcagctgaccgt
accggtcacgcactgttgcacacgctttatcagcagaacctgaaaaaccacaccaccatt
ttctccgagtggtatgcgctggatctggtgaaaaaccaggatggcgcggtggtgggttgt
accgcactgtgcatcgaaaccggtgaagtggtttatttcaaagcccgcgctaccgtgctg
gcgactggcggagcagggcgtatttatcagtccaccaccaacgcccacattaacaccggc
gacggtgtcggcatggctatccgtgccggcgtaccggtgcaggatatggaaatgtggcag
ttccacccgaccggcattgccggtgcgggcgtactggtcaccgaaggttgccgtggtgaa
ggcggttatctgctgaacaaacatggcgaacgttttatggagcgttatgcgccgaacgcc
aaagacctggcgggccgtgacgtggttgcgcgttccatcatgatcgaaatccgtgaaggt
cgcggctgtgatggtccgtgggggccacacgcgaaactgaaactcgatcacctgggtaaa
gaagttctcgaatcccgtctgccgggtatcctggagctttcccgtaccttcgctcacgtc
gatccggtgaaagagccgattccggttatcccaacctgtcactacatgatgggcggtatt
ccgaccaaagttaccggtcaggcactgactgtgaatgagaaaggcgaagatgtggttgtt
ccgggactgtttgccgttggtgaaatcgcttgtgtatcggtacacggcgctaaccgtctg
ggcggcaactcgctgctggacctggtggtctttggtcgcgcggcaggtctgcatctgcaa
gagtctatcgccgagcagggcgcactgcgcgatgccagcgagtctgatgttgaagcgtct
ctggatcgcctgaaccgctggaacaataatcgtaacggtgaagatccggtggcgatccgt
aaagcgctgcaagaatgtatgcagcataacttctcggtcttccgtgaaggtgatgcgatg
gcgaaagggcttgagcagttgaaagtgatccgcgagcgtctgaaaaatgcccgtctggat
gacacttccagcgagttcaacacccagcgcgttgagtgcctggaactggataacctgatg
gaaacggcgtatgcaacggctgtttctgccaacttccgtaccgaaagccgtggcgcgcat
agccgcttcgacttcccggatcgtgatgatgaaaactggctgtgccactccctgtatctg
ccagagtcggaatccatgacgcgccgaagcgtcaacatggaaccgaaactgcgcccggca
ttcccgccgaagattcgtacttactaa

DBGET integrated database retrieval system