KEGG   Escherichia coli BW2952: BWG_0583Help
Entry
BWG_0583          CDS       T00913                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase, FeS subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
ebw  Escherichia coli BW2952
Pathway
ebw00020  Citrate cycle (TCA cycle)
ebw00190  Oxidative phosphorylation
ebw00650  Butanoate metabolism
ebw01100  Metabolic pathways
ebw01110  Biosynthesis of secondary metabolites
ebw01120  Microbial metabolism in diverse environments
ebw01130  Biosynthesis of antibiotics
ebw01200  Carbon metabolism
Module
ebw_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ebw_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ebw_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ebw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BWG_0583 (sdhB)
   00650 Butanoate metabolism
    BWG_0583 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    BWG_0583 (sdhB)
Enzymes [BR:ebw01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     BWG_0583 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     BWG_0583 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_9 Fer4_7 Fer4_18 Fer4
Motif
Other DBs
NCBI-ProteinID: ACR65584
LinkDB All DBs
Structure
PDB: 

Position
659672..660388
Genome map
AA seq 238 aa AA seqDB search
MRLEFSIYRYNPDVDDAPRMQDYTLEADEGRDMMLLDALIQLKEKDPSLSFRRSCREGVC
GSDGLNMNGKNGLACITPISALNQPGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPY
LLNNGQNPPAREHLQMPEQREKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLAAYR
FLIDSRDTETDSRLDGLSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRNA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgagactcgagttttcaatttatcgctataacccggatgttgatgatgctccgcgtatg
caggattacaccctggaagcggatgaaggtcgcgacatgatgctgctggatgcgcttatc
cagctaaaagagaaagatcccagcctgtcgttccgccgctcctgccgtgaaggtgtgtgc
ggttccgacggtctgaacatgaacggcaagaatggtctggcctgtattaccccgatttcg
gcactcaaccagccgggcaagaagattgtgattcgcccgctgccaggtttaccggtgatc
cgcgatttggtggtagacatgggacaattctatgcgcaatatgagaaaattaagccttac
ctgttgaataatggacaaaatccgccagctcgcgagcatttacagatgccagagcagcgc
gaaaaactcgacgggctgtatgaatgtattctctgcgcatgttgttcaacctcttgtccg
tctttctggtggaatcccgataagtttatcggcccggcaggcttgttagcggcatatcgt
ttcctgattgatagccgtgataccgagactgacagccgcctcgacggtttgagtgatgca
ttcagcgtattccgctgtcacagcatcatgaactgcgtcagtgtatgtccgaaggggctg
aacccgacgcgcgccatcggccatatcaagtcgatgttgttgcaacgtaatgcgtaa

DBGET integrated database retrieval system