Escherichia coli K-12 BW2952: BWG_0593 Help Entry BWG_0593          CDS       T00913                                  Symbol ybgT Name (GenBank) conserved protein   KO K00424   cytochrome bd-I ubiquinol oxidase subunit X [EC:7.1.1.7] Organism ebw  Escherichia coli K-12 BW2952 Pathway ebw00190   Oxidative phosphorylation ebw01100   Metabolic pathways ebw02020   Two-component system Module ebw_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:ebw00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     BWG_0593 (ybgT)  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     BWG_0593 (ybgT) Enzymes [BR:ebw01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      BWG_0593 (ybgT) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Motif Other DBs NCBI-ProteinID:  ACR62581 LinkDB All DBs Position 676179..676292 Genome browser AA seq 37 aa AA seqDB search MWYFAWILGTLLACSFGVITALALEHVESGKAGQEDI NT seq 114 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttcgcatggattctgggaacgcttcttgcctgttcgtttggggtaatcacc gcgctggcgcttgaacacgtcgaatcaggcaaagccggtcaagaagacatctga

DBGET integrated database retrieval system