KEGG   Pectobacterium atrosepticum SCRI1043: ECA0012
Entry
ECA0012           CDS       T00186                                 

Gene name
rbsC
Definition
(GenBank) ribose transport permease system protein
  KO
K10440  ribose transport system permease protein
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
eca02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:eca00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ECA0012 (rbsC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eca02000]
    ECA0012 (rbsC)
Transporters [BR:eca02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Ribose transporter
    ECA0012 (rbsC)
SSDB
Motif
Pfam: BPD_transp_2
Other DBs
NCBI-ProteinID: CAG72936
GeneDB: ECA0012
UniProt: Q6DB86
LinkDB
Position
12461..13429
AA seq 322 aa
MSSQSIAAKRWFSKEWLLEQKSLIALLILIAVVSALSPNFFTLNNLFNILQQTSVNAIMA
VGMTLVILTSGIDLSVGSLLALTGAVAASIVGLEVNALVAVFGALAVGALIGAGTGVIVS
KGKVQAFIATLVMMLLLRGVTMVYTNGSPVNTGFSDVADAFGWFGIGRPLGIPTPIWIMA
IVFAAAWYMLHHTRLGRYIYALGGNESATRLSGISVDKIKIIVYSLCGLLSALAGIIEVA
RLSSAQPTAGTGYELDAIAAVVLGGTSLAGGKGRIVGTLIGALILGFLNNGLNLLGVSSY
YQMIVKAVVILLAVLVDNKSSK
NT seq 969 nt   +upstreamnt  +downstreamnt
atgagttctcaatctatcgcggcaaaacgctggtttagcaaagagtggttactggagcag
aaatcgctgatcgcgctcctgatcctgattgcagttgtttccgccctgagccctaacttt
ttcaccctgaataacctgttcaatattcttcagcagacgtcggtgaatgccattatggcc
gtcggcatgacgctggtgatactgacctcgggaattgatttgtcggtgggttcactgctg
gcgctgacgggggctgtagcggcatccatcgttgggcttgaagtgaatgcgctggtggct
gtgtttggcgcactggcggtgggtgcgctgattggcgcgggcaccggtgtcatcgtttct
aaaggtaaagtacaggcgtttatcgccacgctggtcatgatgctgctactgcgcggcgtg
acgatggtctataccaacggtagcccggtgaatactggcttctccgacgttgcagatgct
tttggttggttcggcattggtcgtccgctgggtattccgacgccaatctggattatggct
atcgtattcgctgcggcctggtacatgctgcaccatacgcgcctgggtcgctatatctat
gcgttgggcggtaacgaatccgcaacccgtttatccggcatcagcgttgataaaatcaag
attattgtttattccctgtgtgggctgctgtctgccctggcgggaattattgaagtcgca
cgtttgtcctctgcacagcctacggcgggtacagggtatgagctggatgctatcgcggct
gtggtattgggcggcaccagtctggctgggggtaaagggcgtatcgttggcacgttgatc
ggcgcacttatccttggtttcctcaacaacggactgaatttattaggtgtttcttcttac
taccaaatgatcgtcaaagcagtcgtcattttgctggcggttctggtagataacaaaagc
agtaaataa

DBGET integrated database retrieval system