KEGG   Pectobacterium atrosepticum SCRI1043: ECA0561
Entry
ECA0561           CDS       T00186                                 

Definition
(GenBank) putative membrane protein
Organism
eca  Pectobacterium atrosepticum SCRI1043
SSDB
Motif
Pfam: DUF4400
Other DBs
NCBI-ProteinID: CAG73476
GeneDB: ECA0561
UniProt: Q6D9Q4
LinkDB
Position
628306..629061
AA seq 251 aa
MAEPARNPPPQKPERPHGLLYHVLWGWPWKLIGIVLGSLLLSLLIEYVGIAFFWPTEGAA
HSQQVMNTELGYLSSEFKRSLLFSEPSVTVIHWINTGYHWAFINSGFMDWVSNQYQMQAK
SHSELGRSLNAWSGWLAQSLREYLLATVYVTVVTLVRVTILFLSIPLFAMVVIVAIVEGL
GRRDLRRFGAGYESSFLYHHAKRLVKPAFYVPAMLYLSWPMAVYPNLLLLPAALLFGTAI
TVTTATFKKYL
NT seq 756 nt   +upstreamnt  +downstreamnt
atggctgaacctgcacgtaatcctcccccacaaaaaccagagcgaccacatggattgctt
tatcacgtgttgtggggctggccatggaagttgattggcattgttctcggctcgttattg
ctgagcctgctgattgagtacgtgggcattgcattcttctggcctacagaaggggcggca
cacagtcagcaggtgatgaacactgaactgggctatttatcgtcagaattcaagcgtagt
ctgttgttttccgagccctctgtcaccgtaatccattggatcaacaccggctatcactgg
gcgtttatcaacagtggctttatggattgggttagtaaccaatatcagatgcaggcaaaa
agtcatagtgagctagggcgtagcttaaacgcctggagtggttggctggcacaatcattg
cgggaatatttgctggctactgtatatgtcacggtagttaccttggttagggtcaccatc
ctgtttctctcgatacccttgtttgcgatggtggtaattgtggccattgtcgaagggctg
gggcggcgtgacctgcggcgctttggtgcaggctatgaatccagttttctctatcaccat
gccaaacgcttggttaaacctgcgttttatgtacccgctatgctgtatttgtcctggcct
atggcggtctaccctaacttattattattgccggcagcgttgctatttggtactgcgatt
acagtaacaacggccacatttaaaaaatatctttga

DBGET integrated database retrieval system