KEGG   Pectobacterium atrosepticum SCRI1043: ECA1382Help
Entry
ECA1382           CDS       T00186                                 

Gene name
gpmA
Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
eca00010  Glycolysis / Gluconeogenesis
eca00260  Glycine, serine and threonine metabolism
eca00680  Methane metabolism
eca01100  Metabolic pathways
eca01110  Biosynthesis of secondary metabolites
eca01120  Microbial metabolism in diverse environments
eca01130  Biosynthesis of antibiotics
eca01200  Carbon metabolism
eca01230  Biosynthesis of amino acids
Module
eca_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eca_M00002  Glycolysis, core module involving three-carbon compounds
eca_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECA1382 (gpmA)
  09102 Energy metabolism
   00680 Methane metabolism
    ECA1382 (gpmA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECA1382 (gpmA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:eca04131]
    ECA1382 (gpmA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:eca04147]
    ECA1382 (gpmA)
Enzymes [BR:eca01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     ECA1382 (gpmA)
Membrane trafficking [BR:eca04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    ECA1382 (gpmA)
Exosome [BR:eca04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   ECA1382 (gpmA)
  Exosomal proteins of melanoma cells
   ECA1382 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CAG74292
GeneDB: ECA1382
UniProt: Q6D7E3
LinkDB All DBs
Position
complement(1563014..1563766)
Genome map
AA seq 250 aa AA seqDB search
MAVTKLVLVRHGESQWNNENRFTGWYDVDLSEKGRSEAKAAGQLLKDEGFAFDFAYTSVL
KRAIHTLWSVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
ITPPELTRDDERFPGHDPRYASLSDKELPQTESLALTIERVVPYWTETILPRIKSGERVI
VAAHGNSLRALVKYLDNMGEDEILELNIPTGVPLVYEFDENFKPIKRYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaactaagctagtactggtaagacacggtgagagccagtggaacaacgaaaac
cgcttcacaggctggtacgatgttgatctgtccgaaaagggccgttcagaagccaaagcc
gcaggtcagttgctgaaagacgaaggttttgcctttgatttcgcgtatacctccgtgctg
aaacgtgccattcacacactgtggagcgtactggacgagctggatcaagcctggttgcca
gttgagaaatcctggaaactgaatgagcgccactacggtgcattacagggtctgaacaaa
gcagaaaccgctgagaaatacggtgatgagcaggttaaacaatggcgccgtggtttcgca
atcacacctccagagttgacgcgtgatgacgaacgtttcccgggccacgatccgcgttac
gcttctctgagcgacaaagagctgccacagactgaaagcctagcgctgaccatcgaacgt
gttgtgccttactggaccgaaaccatcctgccacgtatcaagagcggtgagcgcgtcatc
gtcgcagctcacggtaactcactgcgtgcactggtgaaatatctggacaacatgggcgaa
gacgaaattctggaactgaatatcccaactggcgtgccgttggtatatgagttcgacgag
aacttcaagccaatcaaacgttactacctgggcaacgcggacgaaatcgccgcaaaagct
gccgcagtagcgaatcagggtaaagcgaagtaa

DBGET integrated database retrieval system