KEGG   Pectobacterium atrosepticum SCRI1043: ECA1441
Entry
ECA1441           CDS       T00186                                 

Gene name
rfbC
Definition
(GenBank) dTDP-6-deoxy-D-glucose-3,5 epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
eca00521  Streptomycin biosynthesis
eca00523  Polyketide sugar unit biosynthesis
eca01100  Metabolic pathways
eca01110  Biosynthesis of secondary metabolites
Module
eca_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:eca00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    ECA1441 (rfbC)
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    ECA1441 (rfbC)
Enzymes [BR:eca01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     ECA1441 (rfbC)
SSDB
Motif
Pfam: dTDP_sugar_isom
Other DBs
NCBI-ProteinID: CAG74351
GeneDB: ECA1441
UniProt: Q6D784
LinkDB
Position
complement(1635668..1636204)
AA seq 178 aa
MQIIDTAVHGAKIIQPKVFGDARGFFLETFEKRRYQEMLDIDVDFVQDNHSRSSKGVLRG
LHFQKTNPQGKLVRVVRGEVFDVAVDIRQDSPTYGKWYGALLSEENKTQFWLPPGLAHGF
VVLSDIADFEYKCTDYYDPSDEGCLLWNDPDLGIEWPISTPQLSEKDKVGKLFKDLAK
NT seq 537 nt   +upstreamnt  +downstreamnt
atgcaaatcattgatactgctgttcacggcgcaaaaatcattcagccgaaagtattcggt
gatgcgcgaggtttttttctggaaacgtttgaaaagagacgttatcaggagatgctggat
atcgatgtagactttgtccaggataatcattcccgctcaagtaaaggtgtattacgaggt
ctgcatttccagaaaacaaacccgcaggggaaacttgtccgcgttgtacgtggcgaggtt
tttgacgttgcagtagatattcgtcaagattctcctacctacgggaaatggtatggagca
ctcctctctgaagagaacaaaacgcaattttggctccctccggggctagcacatggtttt
gttgtcctctcagatatcgcagatttcgagtacaagtgtacggattattatgaccctagc
gatgagggttgcctattatggaacgatcctgatcttggtatcgaatggccaatatcaacc
ccgcagttatccgagaaagacaaagtaggcaagttattcaaggatctagcaaaatga

DBGET integrated database retrieval system