KEGG   Pectobacterium atrosepticum SCRI1043: ECA1953Help
Entry
ECA1953           CDS       T00186                                 

Definition
(GenBank) putative xylose isomerase
  KO
K01805  xylose isomerase [EC:5.3.1.5]
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
eca00040  Pentose and glucuronate interconversions
eca00051  Fructose and mannose metabolism
eca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ECA1953
   00051 Fructose and mannose metabolism
    ECA1953
Enzymes [BR:eca01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     ECA1953
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: CAG74855
GeneDB: ECA1953
UniProt: Q6D5T7
LinkDB All DBs
Structure
PDB: 

Position
2212644..2213642
Genome map
AA seq 332 aa AA seqDB search
MATYNYPEFGAGLWHFANYIDRYAVDGYGPALSTIDQINAAKEVGELSYVDLPYPFTPGV
TLSEVKDALKDAGLKAIGITPEIYLQKWSRGAFTNPDPAARAAAFELMHESAGIVRELGA
NYVKVWPGQDGWDYPFQVSHKNLWKLAVDGMRDLAGANPDVKFAIEYKPREPRVKMTWDS
AARTLLGIEDIGLDNVGVLLDFGHALYGGESPADSAQLIIDRGRLFGMDVNDNLRGWDDD
LVVGTVHMTEIFEFFYVLKINNWQGVWQLDQFPFRENHVEAAQLSIRFLKHIYRALDKLD
IPALQAAQEAQNPLQAQRIVQDALLSSITVSE
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgtataactaccctgaatttggtgccggtttgtggcattttgcgaattatatc
gaccgctacgccgtagacggctacggcccggcattgagcacgatcgatcagatcaatgcg
gcgaaagaggtcggcgagctttcatatgtcgatctgccttatcccttcacaccgggcgtc
acgctaagcgaagtgaaagatgcactgaaggatgcagggctgaaagcgattggcatcacg
ccggaaatttacctgcaaaagtggtcgcgtggcgccttcaccaaccccgatccggctgct
cgggctgcggcgtttgaactgatgcatgaatctgctggcattgtgcgtgaactcggggcg
aactatgtcaaagtctggccggggcaggatggctgggattatccgtttcaggtcagccat
aaaaatctgtggaagcttgccgttgatggtatgcgcgatctggcaggggctaaccccgat
gtgaaattcgccatcgaatacaaaccgcgtgaaccgcgcgtgaaaatgacctgggattcc
gctgcgagaacgctgctgggtattgaagacatcgggctggataacgtcggcgtgctgctg
gactttgggcatgcgctgtatggcggtgaatcacccgctgattctgcccagttgattatc
gatcgcggtcggctgttcggcatggacgtgaatgacaatctacgtggctgggatgatgat
ttggtggtcggcacggtgcacatgactgagattttcgaattcttctatgtgttgaaaatc
aataactggcagggcgtctggcagctcgatcagttcccgttccgtgagaatcacgttgag
gcggcgcagttgtccatccgtttcttgaagcacatctatcgtgcgctggacaagctggat
attcccgcgcttcaggcggcacaggaagcgcaaaatccgttacaggcacagcggattgtg
caggatgcgctgctgtcatccattaccgttagcgaataa

DBGET integrated database retrieval system