KEGG   Pectobacterium atrosepticum SCRI1043: ECA2110
Entry
ECA2110           CDS       T00186                                 

Definition
(GenBank) conserved hypothetical protein
Organism
eca  Pectobacterium atrosepticum SCRI1043
SSDB
Motif
Pfam: PAAR_motif DUF4150
Other DBs
NCBI-ProteinID: CAG75012
GeneDB: ECA2110
UniProt: I1SBC3
LinkDB
Position
2397840..2398106
AA seq 88 aa
MGNAVKLGDSDTGHGNHPPTPVAAGSSTVKVDGMPLARQGDPLVPHGHDRSISGGSSTVL
IDGKPAARTGDAVSCGGVLIGGGTVSIG
NT seq 267 nt   +upstreamnt  +downstreamnt
atgggtaacgcagttaaattaggcgatagcgacacggggcacggtaaccatccgccgacg
cccgtcgcggcgggctcatcaacggttaaggttgatggtatgccgttggctcgacaaggc
gatcctctggttcctcacggccatgaccggagtattagcggtggttcatccaccgtgctc
attgatggaaagcctgctgctcgcactggtgatgcggttagctgtggcggcgtgttgatt
ggcgggggaacggtaagcattgggtga

DBGET integrated database retrieval system