KEGG   Pectobacterium atrosepticum SCRI1043: ECA2112
Entry
ECA2112           CDS       T00186                                 

Gene name
hrpW
Definition
(GenBank) type III effector protein
Organism
eca  Pectobacterium atrosepticum SCRI1043
SSDB
Motif
Pfam: Pectate_lyase
Other DBs
NCBI-ProteinID: CAG75014
GeneDB: ECA2112
UniProt: I1SBC4
LinkDB
Position
complement(2398528..2399967)
AA seq 479 aa
MADMTITLSIQPGAGLSSTGLNSPLSGSNGGASPRSGQQDSQLMEALSTLLSALLPNSQG
NTPSSTDGSSQGQAGIGNGGSSALGQNGSAADMLMKLLEALIPSKNGQEAGNPLSSGSSG
AAGGNSGASPLTGSSGAGGVGGAQNPEDLSRSLLQDSAGSALNNAINPTADGGGQLSGND
LLKALLELIGNLMDSQKGEFGQPQGSGQSQGGGSPSTGAPQASSGGGGGSPAAPSAPSSS
VGGNGGAASAPLTAAPTGVDGGSAASPTASTAGAGPVSFPTASANPTVVNDTIKVGPGEV
FDGGGKTFTASSKLGDGGQAEGQKPLFELAQGATLKNVVFGDNAADGVHVRGDAKIDNVH
WTNVGEDALTVKSNSGKPANVEITNSSAQGASDKIFQLNADANLTIDNFKAKDFGTFVRT
NGGQQGDWNLNLSNIDAENGKFSFVKSDSEGLNVKGNNINLTNVNNHYKVPDSANLQVN
NT seq 1440 nt   +upstreamnt  +downstreamnt
atggctgatatgacgattacgctcagcatacaacccggcgcaggtctgtcatcgacaggt
ctgaattccccgctttcaggcagcaatggcggggcgtcaccacgttctgggcagcaagat
agccaactgatggaagcgctgagcacattgttgagtgcccttctgcccaattcacaaggc
aatactccctcatcaacagacggcagttcgcagggccaggcagggataggtaatggaggg
agttcagcattagggcaaaacggcagcgctgccgatatgcttatgaaactgttggaagcg
ctgatccctagcaaaaatggccaggaagcagggaatccgctctcttccggttcgtcgggt
gcagcaggcggcaacagcggtgcctcaccgctgacgggttcatccggtgctggaggcgtg
ggtggcgcacaaaacccagaagatctgagccgttccctgctgcaagattctgcaggcagt
gcgttaaataacgcgatcaatccaacggcagacggcggtggccaactgagcggcaacgat
ctgttaaaagcgctgctggaattgatcggtaatttgatggattcacagaaaggtgaattt
ggtcagccgcaaggtagcggccagtcacagggtggcggatcgccgtcaacgggcgcgccg
caggcgtcatctggtggtggaggtggctccccagctgcgccttcagcaccatcttcatca
gtcggcggtaacggcggtgccgcgtccgccccactaacggcggcgccaaccggcgttgat
ggcggttcggccgcatcacccacggcgtcaacagcaggtgctggcccagtttccttccca
accgccagcgctaaccccacagtagtaaacgacaccatcaaagtcggccccggtgaagtt
tttgacggcggcggcaaaacctttaccgccagcagtaaattaggtgacggcggccaggct
gaaggccagaaaccactgtttgagttggctcaaggcgcaacgctgaaaaacgtggtgttt
ggtgataatgcggcggacggcgtacacgttcgcggcgatgccaaaattgataacgtgcac
tggaccaacgtcggtgaagatgcactgacggtgaagtcaaacagcggtaaacctgccaac
gttgaaatcactaacagcagtgctcagggcgcttccgataaaattttccagttgaacgcg
gatgccaacctgactatcgataacttcaaagcgaaagatttcggtacgttcgtccgcacc
aacggcggacaacagggcgactggaatttgaacctgagtaacattgacgcagaaaacggc
aagttctcgttcgtgaaaagcgacagtgaagggttgaacgtcaaaggcaacaatatcaac
ctgacgaacgtcaataatcactacaaagtacccgactccgccaacttacaggtgaattaa

DBGET integrated database retrieval system