KEGG   Pectobacterium atrosepticum SCRI1043: ECA2211Help
Entry
ECA2211           CDS       T00186                                 

Definition
(GenBank) copper-zinc superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
eca  Pectobacterium atrosepticum SCRI1043
Brite
Enzymes [BR:eca01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ECA2211
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: CAG75112
GeneDB: ECA2211
UniProt: Q6D531
LinkDB All DBs
Position
complement(2511298..2511822)
Genome map
AA seq 174 aa AA seqDB search
MKLKALILTGVFFSCSTLAASTTVTLNEALPTGAGSSIGDVSITETPYGLLFTPNLKGLE
AGIHGFHVHENASCEPAEQDGKSVPALAAGGHFDPKKTGKHLGPYDDQGHVGDLPGLVAN
ADGTSTYPILVPRIKSLFEVKNHALMVHVGGDNYADMPAKLGGGGARMACGVIK
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgaaggcacttatcctgacaggcgtgttcttttcctgttctactttggcggca
agcaccacggtgacactgaatgaagcgctgccaacaggcgcaggtagcagcatcggtgac
gtctccattacggaaacaccgtacggcctgcttttcacgccgaacttgaaaggattggaa
gcgggtattcacgggtttcacgtacatgaaaatgccagctgtgaaccagccgagcaagac
ggtaaatcggttcctgcgctggcagcaggcggccacttcgatccgaaaaaaacgggtaaa
caccttggaccttatgacgatcagggacacgtaggtgatttacccggactggtggctaat
gccgatggtacgtcaacttatccgattctggttcctcggataaaatcactgtttgaggta
aaaaatcacgcgttgatggtacatgtcggcggggataactacgcggatatgccagcaaag
ctgggtggtggtggtgcccgcatggcgtgtggtgtgattaagtaa

DBGET integrated database retrieval system