KEGG   Pectobacterium atrosepticum SCRI1043: ECA2869
Entry
ECA2869           CDS       T00186                                 

Gene name
rhs
Definition
(GenBank) putative RHS protein
Organism
eca  Pectobacterium atrosepticum SCRI1043
SSDB
Motif
Pfam: RHS_repeat PAAR_motif DUF4595 RHS
Other DBs
NCBI-ProteinID: CAG75769
GeneDB: ECA2869
UniProt: Q6D375
LinkDB
Position
3207776..3212035
AA seq 1419 aa
MRDDILARIARVGAMHAGNRPTLPSDLPTPGSGSPPTSPGKPIKHSSFLGALLGAVAGAL
VAAAVAAVAVALVGVTGGLAIAVVGGLAVLGAGSLISAVSGRVSAMVDSASPPAGKVDSG
SPNVSVEGSPVSRAEVDVVLCTKHSGPQLIAQGSETVFVNGHPAARIGDKTVCGATIKDG
ASTVFFGSGQATVLEIQDEFSGWQKALLIAVEFLVPPTRGLFRGLGKLFFRGPKAVMKGL
GAGALWAGKRLRQKTRCATRAFKANKGRARVTQAAKAFKKDPVYIASGEVIESRTDIELG
QTIPLVFERTYRTASLHAGLVGRGWQDSWSEVATVSQDEGGTHVTITLAQGYDIDFTFGL
GATVVYCAEYPEFKLLRRHNGFHLWHRDSQTWRAFTVKQGDQLLLSVITDNHQNRIDFLR
DPKGYLRKIQHSDGIELLLVWQGEFLRQVQRIDGGQKTVLAEYRQDEQGRLVEADAAHAY
HLFYEYDNHHRLTRWHDNDKTWARYEYDHQGRCTYTTCADGYLTAKFEYLADRVVMTDGL
GQRSEYGFNDLHLMAWETSPLDHITRYEYDDVGNLLREISPAGRVVEFAYLEDTGLVSTF
TDGSDHQWQYAYDDHERLIGITDPLGRNWAWQYDSKGNPQSLTGPDNSEVRFAWNRYGLL
TEVSNEQGQIQASLFYDQRQRLMSATDAEYRTQQLRYDPQDRLTTWTRPDGSTYRLGYRR
ASWRLPEQLIRPDEKEEKRQYDKHNNLLNYTDGNGAVWQQTYGPFDLLMSRTDAEGRTWQ
YDYDKDSQQLIGVTAPDGNRWQWWLDADGRVIRERDMAGTETLYGYDEDGHCITVRNGEG
ETRHFLYDGRCLLIKETAPDDTLHYRYDAAGRLTDVTSTTSHVQLAYDERDRVIEEVNSG
TAIRRHYQGASHTVTRSLHREGEEESAALTSTFRYRATGELHQVQLPDGAELTLTHDAAG
REATRHSTGGFLQQSEYDTMGWLTREMSGQTVDGRLQPVQTREYLYDSAGNLTGTRRNRE
AAGYRLDACGRVLSVLSGGSGRDVNTEEQYRYTRSGLPQDVTRLTEWQAGRLTQQDNTHY
QYDKAGRLIRKQVVQPGYRPQVWHYRWDSRNQLRVVDTPTGERWFYRYDPFGRRIGKRCE
QTQDELHYLWDGDRIAEVRHYRDSQLISHRHWVHNGWELLVQQRQNTDGSWETDFVTSGH
NGEPQAIFNQQGELRWQAPRTNLWGQRYTDNTENLDPGLAFAGQYRDAESGLCYNRFRYY
EPSGGGYISPDPIGLLGGESNYGYVQNPNTWVDPLGLAKCQLAKSGKDLYVGTYSQVRGA
NIKSGLNPTHTPHHAIQNAASPTTHGRGITINMRKDLHELTWTYKKPMVRGLSNREYLAR
DIVDLRNILGNAGYSRDVINRQLGELVKQNKELWKTLGQ
NT seq 4260 nt   +upstreamnt  +downstreamnt
atgcgtgatgacattctggcccgtattgcgcgtgtcggcgcgatgcacgcgggcaatcgg
cccacgctgccctcggacttaccgacaccgggtagcggctcgccgccgacctcaccgggc
aagcctatcaaacacagcagctttctgggggcgctgctcggtgccgttgccggggcgctg
gttgctgctgcggtcgcggcggtggccgttgctctggtgggcgtcaccggtggactggcg
attgccgtggttggtgggctggcggtgctgggggcgggaagcctgatatcggcggtcagt
ggtcgggtatccgccatggtggacagtgcctcaccgcctgcggggaaagtggacagtggt
tcaccgaatgtatcggtggaagggagtccggtttcccgtgctgaagtcgatgtcgttctc
tgcaccaaacacagcggtccgcaactgattgcgcagggcagcgaaaccgtctttgtgaac
ggtcatccggctgcacggattggtgataaaaccgtgtgtggtgccaccatcaaggacggt
gcatcgacggtgttctttggctccggtcaggctaccgtactggagatacaggacgagttc
agcggctggcagaaagcgctgctgattgcggtggaatttctggtaccgccaacacgtggc
ctgtttcgcgggttggggaagttattctttcgcggccccaaagcggtgatgaaaggactg
ggcgcgggtgcactttgggcaggtaagcgtctcaggcaaaagacacgttgcgccacccgt
gcatttaaggcgaacaagggccgggcgcgggtgacacaagcggccaaagccttcaagaaa
gacccggtgtatatcgccagcggtgaggtgattgaaagtcgcactgatatcgaactggga
caaactatcccgctggtgttcgaacgtacttatcgtaccgcctctttacatgccggatta
gtaggccgtggctggcaggatagctggagcgaggtcgctaccgtcagtcaggatgagggc
ggcacccatgtcactatcacgctggcacagggctatgacattgatttcaccttcgggctc
ggtgccaccgtggtgtactgcgccgaataccccgaattcaagctgctgcgacggcataac
ggttttcacttgtggcaccgcgacagccagacctggcgtgcctttaccgtcaaacagggt
gaccagttgctgttgtcggtcattaccgacaaccaccagaaccgcatcgactttctccgc
gaccccaaaggctacctgcgcaagatacagcacagcgacggcatcgagctgctgctggta
tggcagggcgagttcctgcgccaggtgcagcgcattgacggtggtcagaaaacggtgctg
gccgaataccgtcaggatgaacaaggccgactggtcgaggcagatgccgctcatgcctat
cacctgttctacgagtatgacaaccatcatcgtctgactcgctggcacgacaacgacaaa
acctgggcgcgttatgagtatgaccatcaaggcaggtgtacctacaccacctgtgccgac
ggctacctgacggcgaagtttgagtacctggccgaccgggtggtgatgactgacgggcta
ggccaacgcagtgaatatggtttcaatgacctgcacctgatggcgtgggagacatccccg
ctcgaccatatcacccgctatgagtatgacgatgtgggcaacctgctgcgggaaatctcc
ccggcgggccgggtggtggaatttgcctatctggaggataccggactggtcagcaccttc
accgacggcagcgaccaccaatggcagtacgcctacgacgaccatgagcggcttatcggt
attactgacccactcgggcgcaattgggcatggcagtacgacagcaagggcaacccgcag
agcctgaccggaccggacaacagcgaagtgcgttttgcctggaatcgctacggcctgctg
acggaggtgagcaacgaacaaggtcagatacaggctagcctgttctatgaccagcgtcag
cgactgatgagcgccaccgatgcggagtatcgcacccagcaactgcgctacgacccgcag
gacagactgaccacctggacacgcccggatggttcaacctatcggctaggctaccgccgt
gcaagctggcgactaccggagcaactgatacgccccgacgaaaaagaggaaaaacgccag
tacgataaacataacaacctgctgaactacaccgacggcaatggtgcggtctggcagcaa
acctatggcccgttcgacctgctgatgtcacgcactgacgccgaaggccgcacctggcag
tacgattacgataaagacagtcagcaactgattggcgtcaccgcaccggatggcaaccgc
tggcagtggtggctggatgcggacggacgggttatccgcgaacgggacatggccggcacg
gaaaccctctacggctacgatgaagacggccactgcatcaccgttcgcaatggtgaaggc
gaaacccgccacttcctgtatgacggacgctgcctgcttatcaaagaaaccgcgccggac
gatacgctgcattaccgctacgatgcggcaggtcggctgaccgacgtgacgtctaccacc
agtcatgtccagttggcgtatgacgagcgcgaccgggtgatagaggaggtgaacagcggc
acggcaatccgacgccactatcagggcgcatcgcacaccgtcacccgcagcctgcacagg
gaaggcgaagaggaaagcgcggcgctcaccagcaccttccgctaccgcgccacgggcgaa
ctgcatcaggtgcagttgccggatggtgcagagctgacgctgactcacgatgcagccgga
cgggaagcgactcgccacagcacgggcggctttctgcagcagagtgaatacgacacgatg
ggctggctgacgcgcgagatgagcggacagacagttgacggtcgcctgcagccagtgcaa
acccgcgaatacctctacgatagcgcgggtaacctgacgggcacccgacgcaaccgcgaa
gccgcaggctaccgactggatgcctgcggacgggtactgtcagtactgagcggcggctca
gggcgcgacgtcaacaccgaagaacaataccgctacacccgcagcggcctgccgcaggat
gtgacccgactgaccgagtggcaggctgggcgactgactcaacaggacaacacccactat
cagtacgacaaagctgggcggctcattcgcaagcaggtggtgcagccgggctatcggccg
caggtatggcactaccgctgggacagccgtaatcagctcagggtggtggacacgccgaca
ggggaacgctggttctaccgttacgacccgttcggacgacgcatcggcaagcgttgtgag
caaacgcaggacgaactccactacctgtgggacggcgaccggattgccgaagtacggcac
taccgcgacagccagcttatcagccaccgccactgggtgcataatggctgggagctgttg
gtgcagcagcgccagaatacagacggcagctgggaaacggactttgtcaccagcggccac
aacggcgaaccgcaggccatctttaatcagcaaggtgaactgcgctggcaggccccgcgc
accaacttatggggccagcgttatacagataatactgaaaatcttgatccggggctggcc
tttgctggtcaataccgtgacgctgaaagtggcttgtgctataacagattccggtattat
gagccaagtggtggtggttatatctcgcctgacccgatagggttgctggggggggagagt
aactatgggtatgtgcagaatcccaatacgtgggttgatccgctgggattagcgaagtgt
caattagctaaatctgggaaagacttatacgtaggaacatatagccaagtcaggggtgct
aacattaaatctggattgaatcctacgcatacccctcaccatgctattcaaaatgcggca
agcccaacaactcatggacgaggaataacaattaatatgcgaaaagaccttcatgaattg
acttggacttacaaaaaaccgatggttcgtggtttaagtaatcgtgagtatttggctaga
gatattgttgacttgcgtaatatattgggcaatgcgggttatagccgagatgttataaat
cgccaattgggtgaattagttaagcagaacaaagaactttggaaaacattggggcaataa

DBGET integrated database retrieval system