KEGG   Pectobacterium atrosepticum SCRI1043: ECA3382
Entry
ECA3382           CDS       T00186                                 

Definition
(GenBank) hypothetical protein
Organism
eca  Pectobacterium atrosepticum SCRI1043
SSDB
Motif
Pfam: RHS_repeat
Other DBs
NCBI-ProteinID: CAG76281
GeneDB: ECA3382
UniProt: Q6D1R4
LinkDB
Position
complement(3799229..3799516)
AA seq 95 aa
MSQIAPGLGETLKVQDAVVQSSVRYDTAGRVVERGHTQYRYDDCGRLAMKRETRPGFRPK
ETYFDWDVQDRLLRVSLPDGARWRLIQMEVISLPY
NT seq 288 nt   +upstreamnt  +downstreamnt
gtgtcgcagatagcgccgggtctgggtgagacgctgaaggtgcaggatgcggtggtacag
tcgtcggtgcggtatgatacggcgggtcgggtggtggagcgcggccatacgcagtaccgg
tatgatgactgcgggcgtctggcgatgaaacgggaaacgcgtccggggttcaggccgaag
gaaacgtacttcgactgggacgtgcaggaccgactgttgcgggtgagcctgccggacggg
gcgcggtggcgtttaattcaaatggaagttatttcacttccatattaa

DBGET integrated database retrieval system