KEGG   Pectobacterium atrosepticum SCRI1043: ECA3426
Entry
ECA3426           CDS       T00186                                 

Definition
(GenBank) putative phospholipase
Organism
eca  Pectobacterium atrosepticum SCRI1043
SSDB
Motif
Pfam: PAAR_motif DUF2974 Abhydrolase_6 Lipase_3 Abhydrolase_1 TetR_C_31 Hydrolase_4 RcsF
Other DBs
NCBI-ProteinID: CAG76326
GeneDB: ECA3426
UniProt: Q6D1L9
LinkDB
Position
complement(3837677..3839050)
AA seq 457 aa
MPGAARLGDSCVGHGCFPATPIIEGSGDVIINGKPAARKGDGVLLHACPCPNMPHGVHNR
AISAGSGTVIINGKLAARIGDAIGCGGSVAAGSGNVIIGDSPYQSPVKPCAEQSAKSRAP
LLALTPMLLPTLMEWASVAELPILDDLLSVAQRKERYLARAKLATEAATLPGLADAAKRL
AFNNDSILRAEAAQYVYSVDEFRRGVLDKLPKAPVGLELLDVQKLPGLTDNDFMDKKTGF
GSALFKSAINGETMLTYRGTNNAVTGVKDWLTNATQGMGFESAQYKQAMDLATQVKDLMP
NPPPVIVGHSLGGGLASAAVSATKLPGYTFNAAGLHENTALRGGGATLAETASLIKTQAV
DGEILTMVQTYGKALIPGLLSGAGALIGGTAGAALGGVIGVAKLLGGGLPKASGDMMALP
AVGGSPIARHGMDQVVAGIESQKKEDIGKITNTFRGI
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgccaggtgctgcacgtttaggagacagctgcgtaggtcacggttgttttcctgcgacc
ccaattattgaaggcagcggtgatgtcatcatcaatggcaaaccagcggcccgtaaaggt
gatggggttttgctccatgcttgcccttgcccgaatatgcctcacggcgtacacaatcga
gcgatatctgcgggctccggtacggtcatcatcaatggaaagctggcggcgcgtatcggt
gatgcgatcggctgtggcggctcggttgctgctggcagcgggaatgtgatcattggcgac
tcgccttatcagtccccggttaaaccgtgcgccgaacaatcggccaaaagccgcgcgcct
ctgttggcattgacgccaatgctgttgccgacattaatggaatgggcttcggtcgccgag
ttgcccattcttgatgatctgctctctgtcgcacagcgtaaagagcgctatctggctcgt
gccaagttggcgaccgaggcggcgacgctgccgggattagccgatgcggcaaagcggttg
gcgtttaataacgacagcatcttgcgcgcggaggcggctcagtacgtttattcggtcgat
gaatttcgacgaggagtgctggataaactgcctaaggctccggttggtctggaactgctg
gatgtccaaaaacttcctggtttgacggacaatgattttatggataagaaaacagggttt
ggttctgccctgttcaaatcagcgattaatggtgaaaccatgttgacctataggggtacc
aataatgcggtgacgggagtgaaagactggttgactaacgccactcagggtatgggattt
gaatcagcgcagtacaaacaagcaatggatctcgcgactcaagtcaaagatctgatgcca
aatcctccacctgttattgttggccactctctggggggcgggttagcctctgcagcggtc
agtgcgacaaaacttcccggctatacgttcaatgccgcaggattacatgagaatactgcc
ttgcgaggtggtggtgcgacattggcagaaacggcatcattgattaaaacacaagcggtt
gatggcgagatattaaccatggtgcaaacctacggtaaagctttgattccaggcttgcta
tccggtgcgggcgcattgattggcggaaccgccggtgcggcgctagggggcgttatcggt
gttgcaaagctactgggaggggggctgccgaaagcaagcggtgatatgatggcgcttccc
gctgttggcggttcaccgattgcgcgtcacggtatggatcaggtagttgcgggtattgaa
agccagaaaaaggaagatatcgggaagataaccaatacattcaggggaatataa

DBGET integrated database retrieval system