KEGG   Pectobacterium atrosepticum SCRI1043: ECA3478
Entry
ECA3478           CDS       T00186                                 

Definition
(GenBank) conserved hypothetical protein
Organism
eca  Pectobacterium atrosepticum SCRI1043
SSDB
Motif
Pfam: PAAR_motif DUF4150
Other DBs
NCBI-ProteinID: CAG76377
GeneDB: ECA3478
UniProt: Q6D1G8
LinkDB
Position
complement(3899535..3899801)
AA seq 88 aa
MGNAVKVGDSDTGHGSHPPTPVASGSSTVKVDGMPLARQGDPLAPHGHERSISSGSSSVL
VEGKPAARTGDAVSCGGVVMGGGTVTIG
NT seq 267 nt   +upstreamnt  +downstreamnt
atgggtaacgccgttaaagtaggcgatagcgatacggggcacggcagtcatccaccgacg
cctgtcgcttcaggctcatcaacggttaaggttgacggcatgccgttggcccgacaaggc
gatcctttggctcctcacggccatgagcggagcattagcagcggttcatccagcgtactc
gttgagggtaaacccgcggcgagaacgggtgatgcagtgagctgtggtggcgtggtgatg
ggcgggggaaccgttaccattggatga

DBGET integrated database retrieval system