KEGG   Pectobacterium atrosepticum SCRI1043: ECA4093Help
Entry
ECA4093           CDS       T00186                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase I
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
eca  Pectobacterium atrosepticum SCRI1043
Pathway
eca00400  Phenylalanine, tyrosine and tryptophan biosynthesis
eca01100  Metabolic pathways
eca01110  Biosynthesis of secondary metabolites
eca01130  Biosynthesis of antibiotics
eca01230  Biosynthesis of amino acids
Module
eca_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:eca00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ECA4093 (aroK)
Enzymes [BR:eca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     ECA4093 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI AAA_33 AAA_18 Cytidylate_kin dNK Cytidylate_kin2 AAA AAA_16 AAA_22 TsaE APS_kinase ABC_tran AAA_5 AAA_25 AAA_7 AAA_17 Ploopntkinase3 AAA_24 RNA_helicase AAA_28 AAA_PrkA His_biosynth AAA_29 RsgA_GTPase AAA_14 Mg_chelatase IstB_IS21
Motif
Other DBs
NCBI-ProteinID: CAG76990
GeneDB: ECA4093
UniProt: Q6CZQ8
LinkDB All DBs
Position
complement(4562473..4562994)
Genome map
AA seq 173 aa AA seqDB search
MAEKRNIFLVGPMGAGKSTIGRQLAQQLNMEFFDSDQEIERRTGADVGWVFDVEGEEGFR
DREEKVINELTEKQGIVLATGGGSVKSRETRNRLSARGVVVYLETTIEKQLARTQRDKKR
PLLQVETPPREVLEALAKERNPLYEEIADVTIRTDEQSAKVVANQIINMLESN
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaaacgcaatatctttctggttgggcctatgggtgccggcaaaagcactatt
ggccgtcaattagctcagcaactcaatatggagtttttcgactccgatcaagaaattgag
cgacgcactggggctgatgtgggctgggtattcgatgtggaaggcgaagaaggcttccgc
gatcgtgaagagaaagtcattaatgaattgacggaaaagcaaggcatcgtactggcgaca
ggcggtggctcagtcaaatcacgtgagacgcgcaatcgtctttcagcgcgcggcgttgtc
gtttatttggaaacgacaatcgagaaacaactggcccgcacgcagcgtgacaagaaacgt
ccgttacttcaggttgaaacccctccacgtgaagtattggaagcgttggcgaaagagcgg
aacccgctttatgaagaaatcgctgatgttaccattcggactgacgagcaaagtgccaag
gtcgttgctaaccagattatcaatatgctggaaagtaactaa

DBGET integrated database retrieval system