KEGG   Pectobacterium atrosepticum SCRI1043: ECA4287
Entry
ECA4287           CDS       T00186                                 

Definition
(GenBank) hypothetical protein
Organism
eca  Pectobacterium atrosepticum SCRI1043
SSDB
Other DBs
NCBI-ProteinID: CAG77184
GeneDB: ECA4287
UniProt: Q6CZ66
LinkDB
Position
4803540..4803905
AA seq 121 aa
MTPEQAASIRAGNGISRPTPYHRTTPTQHVAGAPHSRDPWISTTRSQSTAEYFATHGGTQ
AANPIVNIDLSKIPSDKILDVSNAQKAAEHLQTPFTRNVAAAHQEVLIFGEIPSEAIIGF
L
NT seq 366 nt   +upstreamnt  +downstreamnt
gtgactcctgaacaagcagcaagtatccgagcaggcaatggaatatcaaggccgactcca
tatcatagaacgacaccgactcagcatgtagcaggagcaccgcactcgcgtgatccgtgg
atatcaacaactagaagtcaatcaacagcagaatacttcgccactcatggtggaacccaa
gcagcaaatccaattgttaatatagatctgtctaaaattccgagcgataagattttagat
gtatcaaacgctcaaaaggctgcggaacatttgcagactccattcacccgaaatgtagcg
gcagcccaccaagaagtattaatctttggagaaataccatcggaagcgataattggattt
ttatag

DBGET integrated database retrieval system