KEGG   Enterobacter cancerogenus: CWI88_06520Help
Entry
CWI88_06520       CDS       T05545                                 

Gene name
fadJ
Definition
(GenBank) fatty acid oxidation complex subunit alpha FadJ
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ecan  Enterobacter cancerogenus
Pathway
ecan00071  Fatty acid degradation
ecan00280  Valine, leucine and isoleucine degradation
ecan00281  Geraniol degradation
ecan00310  Lysine degradation
ecan00362  Benzoate degradation
ecan00380  Tryptophan metabolism
ecan00410  beta-Alanine metabolism
ecan00640  Propanoate metabolism
ecan00650  Butanoate metabolism
ecan00903  Limonene and pinene degradation
ecan00930  Caprolactam degradation
ecan01100  Metabolic pathways
ecan01110  Biosynthesis of secondary metabolites
ecan01120  Microbial metabolism in diverse environments
ecan01130  Biosynthesis of antibiotics
ecan01200  Carbon metabolism
ecan01212  Fatty acid metabolism
Module
ecan_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ecan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CWI88_06520 (fadJ)
   00650 Butanoate metabolism
    CWI88_06520 (fadJ)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CWI88_06520 (fadJ)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CWI88_06520 (fadJ)
   00310 Lysine degradation
    CWI88_06520 (fadJ)
   00380 Tryptophan metabolism
    CWI88_06520 (fadJ)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CWI88_06520 (fadJ)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CWI88_06520 (fadJ)
   00281 Geraniol degradation
    CWI88_06520 (fadJ)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    CWI88_06520 (fadJ)
   00930 Caprolactam degradation
    CWI88_06520 (fadJ)
Enzymes [BR:ecan01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     CWI88_06520 (fadJ)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CWI88_06520 (fadJ)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     CWI88_06520 (fadJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 DUF362
Motif
Other DBs
NCBI-ProteinID: AUJ80714
UniProt: A0A2I6E2Y9
LinkDB All DBs
Position
1368957..1371104
Genome map
AA seq 715 aa AA seqDB search
MDTTSAFNLVVRLDNVAVITIDVPDEKMNTLKAEFGVQVREMLKHVRENKALRGLVFISA
KPDNFIAGADINMIARAQSAQEAEALARQGQQVMAEIHALPIPVIAAIHGACLGGGLELA
LACHSRICTDDAKTVLGLPEVQLGLLPGSGGTQRLPRLVGVSTALEMILTGKQLRARQAL
KTGLVDEVVPQAILLDAAVERALKGRQAKRPLPVRERILAGPLGRAVLFKLAGKKTEQKT
RGNYPAAKRILEVIETGLSQGASSGYAAEAKAFGELAMTPQSQALRNIFFASTEVKKDPG
SDAAPAPLQAVGVLGGGLMGGGIAFVTASKGKLPVRIKDINAKGINHALQYSWQNLDRKV
KRRHIKASERDKTLAMITGTTDYSGFRHRDLVIEAVFEDLALKQQMVADVEAHCAPHTIF
ASNTSSIPIGEIAANAARPEQVIGLHFFSPVEKMPLVEVIPHANTCPQTVATVVKLAKKQ
GKTPIVVADKAGFYVNRILAPYINEAMRLLTEGEKIEHVDEALVTFGFPVGPIQLLDEVG
IDTGTKIIPVLEAAYGDRFSPPANIVSAILKDDRKGRKNERGFYLYAAKGRKSKKQVDPS
VYGLITTTGQGRLSAAQCAERCVMMMLNEAARCFGEQVVKSARDGDIGAVFGIGFPPFLG
GPFRYMDTLGAGEVVAILQRLASQYGPRFTPCDELLQMAERGQTFWPARETVLVS
NT seq 2148 nt NT seq  +upstreamnt  +downstreamnt
atggacacgacatctgcatttaatctggttgtacgcctcgataacgtcgccgtcatcacc
atcgatgtgcctgatgaaaagatgaataccctgaaggcagagtttggcgtgcaggtgcgc
gagatgctaaagcacgttcgcgagaacaaagccctgcgcggcctggtttttatctccgcc
aagccggataattttatcgccggagcggatatcaacatgattgcccgcgcgcaaagcgct
caggaagccgaagcgctggcgcgtcaggggcagcaggtgatggcagaaattcatgcgctg
ccgatccccgtcattgcggcgatccacggcgcgtgcctgggcggcgggctggagctggcg
ttagcctgtcatagccgcatctgtaccgacgatgcgaaaaccgtgctgggcctgcctgaa
gtgcaacttgggctgctgcccgggtccggcggaacgcagcgcctgccgcgtctggtgggg
gtaagcaccgcgctggagatgatcctcaccgggaaacagcttcgcgcccgccaggcgctg
aaaaccggcctggtggatgaggtggtcccgcaggcaatcttgctcgacgccgccgttgaa
cgcgcgctaaaaggacgacaggcaaaacgtcccctgccggtgcgcgagcgcattctggcc
gggccgctggggcgtgcggtgctgttcaaactggcaggcaagaaaaccgagcaaaaaaca
cgaggtaactatccggcggcgaagcggatcctggaggtgattgaaaccgggttatcgcaa
ggtgccagcagcggttatgccgccgaagcaaaagcctttggcgagctggcgatgacgccg
caatctcaggcgctgcgcaacattttctttgccagcacggaggtaaaaaaagatcccggt
agcgatgcggcacccgcgccgctgcaggcggttggcgtgctggggggcgggctgatgggg
ggtggcattgcgtttgttaccgccagtaaaggcaaattgcccgtacgtatcaaagacatc
aatgcgaaggggataaatcacgcgctgcagtacagctggcagaaccttgatcgcaaggtc
aaacgccgccatatcaaggcaagcgagcgggataaaaccctggcgatgattacgggcacc
acggactacagcggcttcaggcatcgcgatctggtgattgaggccgtgtttgaagacctg
gcgctcaaacagcaaatggttgcggatgtcgaggcgcactgtgcgccgcacaccattttt
gcgtcgaatacctcatccatcccgattggggagattgcggccaacgccgcacgtcctgag
caggtgattgggctgcacttctttagccctgtcgaaaaaatgccgctggtggaagtcatc
ccgcacgccaacacctgcccgcaaacggtcgctacggtggtgaagctggcgaaaaagcag
ggtaaaacgcccattgtggtagcggataaagccggcttctacgtcaaccgtatcctggca
ccgtatatcaatgaagcgatgcggttgctgacggagggcgaaaagatcgaacacgtcgac
gaggcgctggtcacctttggcttccccgttggtccaatccaacttttggatgaggtagga
atcgacactggcactaaaattatacctgtactggaagccgcttacggcgatcggtttagc
ccgcctgcaaacattgtttctgcaattttgaaggacgatcgcaaaggcagaaaaaatgaa
cgcggtttctatctttacgctgcaaaagggcgtaaaagcaagaaacaggtcgacccttca
gtttatgggctcattacgaccacagggcagggaagactgtcggcggctcagtgtgctgaa
cgctgcgtcatgatgatgcttaacgaggcggcgcgctgcttcggtgagcaggttgtcaaa
agcgcacgcgatggcgacatcggtgccgtatttggtataggtttcccgcccttccttggc
ggcccgttccggtacatggataccctcggtgcgggtgaagtagttgcaattctgcaacgt
cttgcctcgcagtatggtccgcgctttacaccgtgtgacgaattattgcagatggcggag
cggggccagacattttggcctgcaagagaaactgtcctcgtaagctga

DBGET integrated database retrieval system