KEGG   Enterobacter cancerogenus: CWI88_07075
Entry
CWI88_07075       CDS       T05545                                 

Definition
(GenBank) DotU family type IV/VI secretion system protein
  KO
K11892  type VI secretion system protein ImpK
Organism
ecan  Enterobacter cancerogenus
Pathway
ecan03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:ecan00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    CWI88_07075
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:ecan02044]
    CWI88_07075
Secretion system [BR:ecan02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   CWI88_07075
SSDB
Motif
Pfam: DotU Catalase-rel
Other DBs
NCBI-ProteinID: AUJ80820
LinkDB
Position
1492342..1493031
AA seq 229 aa
MTERKRGTAASIDIDALLQDTWLQVISLRHGPTFLEGEGRTLWERCIADVERVQRELKAC
ELDEASCQHILTAQCALLDEAVKGRGVEDDACLQWYDIPLQGHFLGTMDAGDTLCDRMRD
VLRVPAPEHAVMTCFQRVMMLGFLGSFRSLNDPERQRLINALSEHVVPFSYPQSQPILAE
SRARQGIGGWLASWPVRIGLSVVVVATLWWGLDRWLDQMLQTLLPGAVK
NT seq 690 nt   +upstreamnt  +downstreamnt
atgactgagcgtaaacgcggcactgccgcgtccattgatattgatgccctgctgcaggat
acatggctccaggtgatcagtctgcgtcacggcccgacattcctggagggcgaagggcgt
acgctatgggagcgctgcattgctgatgtcgaacgtgtgcagcgtgaactgaaagcgtgc
gaacttgatgaagccagctgccagcatattctcacggcacaatgtgcgctgctcgatgag
gcagtcaaaggccgcggtgtggaggatgacgcctgcctgcagtggtatgacattcccctg
caggggcatttcctgggcaccatggacgccggcgacacgctgtgcgatcggatgcgcgat
gtgctgcgtgtaccggcacctgaacacgctgtcatgacatgctttcagcgggtcatgatg
ctggggttcctcggcagtttccgctccctgaacgatccggagcgccagagacttatcaac
gcactcagcgaacatgtcgtgccgttcagctatccacagtcccaacccatccttgcggaa
agtcgtgccagacagggaataggcggctggctggcgtcatggcccgtgcgaataggccta
agtgtggtggtggtggccacactctggtgggggctggatcgctggctggatcagatgctg
cagaccctgttgccgggagccgtgaaatga

DBGET integrated database retrieval system