KEGG   Enterobacter cancerogenus: CWI88_08395Help
Entry
CWI88_08395       CDS       T05545                                 

Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
ecan  Enterobacter cancerogenus
Pathway
ecan00500  Starch and sucrose metabolism
ecan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CWI88_08395
Enzymes [BR:ecan01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CWI88_08395
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 Alpha-amylase_C CdhD DUF1939
Motif
Other DBs
NCBI-ProteinID: AUJ81061
UniProt: A0A2I6E3Z8
LinkDB All DBs
Position
complement(1788876..1790363)
Genome map
AA seq 495 aa AA seqDB search
MKNPTLLQCFHWYYPTGGELWPEVTALAPNLNEIGINMVWLPPAYKGASGGYSVGYDSYD
LFDLGEFDQKGSVATKYGDKAQLLEAINALKSNDIAVLLDVVVNHKMGADEKEPVRVQRV
NQEDRTQIDDEIIECEAWTRYSFPVRAGQYSQFVWDYKCFSGIDHIENPNEDGIFKIVND
YTGDGWNDQVDNEMGNFDYLMGENIDFRNRAVTEEIKYWARWVMEQTQCDGFRLDAVKHI
PAWFYKEWIEHVQEVSEKPLFVVAEYWSHDVDALKNYIDQVEGKTMLFDAPLQMKFHEAS
RMGREYDMSQIFTGTLVETDPFHAVTLVANHDTQPLQALEAPVEAWFKPLAYALILLREN
GVPSVFYPDLFGATYDDTGGDGETYHIEMPVIEQLHELILARQRFAHGVQTLFFDHPNCI
AFSRSGTEDDPGCVVVLSNGDDGEKTICLGENYGNKTWRDFLGNREETVTTAADGEGTFT
CNGGSVSVWVIEDAL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaccccaccctattacaatgttttcactggtactaccctactggcggcgagtta
tggcctgaggtcacggcgttagccccaaatctgaatgaaattggcatcaatatggtctgg
ctgcccccggcgtataaaggcgcatccggcggctattccgtgggctacgactcgtacgat
ctgttcgaccttggcgagtttgaccagaaaggcagcgtagccacgaaatatggtgacaag
gcccagctgcttgaggccatcaacgccctgaaaagcaatgacattgcggtgctgctggac
gtggtggttaaccacaaaatgggggcggacgagaaagagcctgttcgcgtgcagcgcgtg
aatcaggaggatcgcacgcagattgacgatgaaatcatcgagtgtgaggcctggacccgc
tacagcttccccgttcgcgcggggcagtattcgcagttcgtctgggactataaatgtttc
agcggcattgaccatatcgaaaaccccaacgaagacggcatctttaaaatcgttaacgat
tacaccggcgatggctggaacgatcaggtcgataatgagatgggtaatttcgactacctg
atgggcgaaaacatcgattttcgcaatcgtgccgttaccgaagagatcaaatactgggca
cgctgggtgatggaacagacgcagtgcgatggcttccgtctggatgcggttaagcacatt
cccgcctggttctataaagagtggattgaacacgttcaggaagtgtcggaaaaaccgctg
ttcgtggtggcagaatactggtcacacgacgtcgacgcgctgaagaactatatcgatcag
gtcgaaggcaaaaccatgctattcgatgccccgctgcagatgaaattccacgaggcgtcg
cgcatgggccgcgagtacgacatgagccagatctttaccggcaccctggttgaaacggat
ccattccacgccgtcaccctggtggctaaccacgacacccagccgctgcaggcgctggaa
gcgccggtagaagcctggttcaaaccgctggcgtatgcgcttattctgctgcgcgagaac
ggcgttccgagcgtgttctatcccgatttgttcggtgcgacctacgacgacaccggcggt
gacggcgagacgtatcacattgagatgccggtcattgaacagcttcacgagctgatcctc
gcccgccagcgttttgcccacggggtacaaaccctgttcttcgatcatcccaactgcatt
gcgtttagccgcagtggaaccgaagacgaccccggctgcgtggtggtcctttccaatggc
gatgacggtgagaagacgatctgccttggcgagaactacggcaacaaaacctggcgtgat
tttcttggcaaccgggaagagacggtgactaccgcagcggatggcgaaggcacctttacc
tgcaatggcggaagcgtaagcgtgtgggtgattgaggacgcgttgtaa

DBGET integrated database retrieval system