KEGG   Enterobacter cancerogenus: CWI88_11680Help
Entry
CWI88_11680       CDS       T05545                                 

Definition
(GenBank) multiple antibiotic resistance transcriptional regulator MarR
  KO
K03712  MarR family transcriptional regulator, multiple antibiotic resistance protein MarR
Organism
ecan  Enterobacter cancerogenus
Brite
KEGG Orthology (KO) [BR:ecan00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ecan03000]
    CWI88_11680
Transcription factors [BR:ecan03000]
 Prokaryotic Type
  Helix-turn-helix
   MarR family
    CWI88_11680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR MarR_2 HTH_27 HTH_24 HTH_34 TrmB FeoC RP-C
Motif
Other DBs
NCBI-ProteinID: AUJ81664
UniProt: A0A2J7P3L1
LinkDB All DBs
Position
2439119..2439553
Genome map
AA seq 144 aa AA seqDB search
MKSTSDLFNDIIPLGRLIHMVNQKKDRLLNDYLSPLDITATQFKVLCSIRCEVCITPVEL
KKVLSVDLGALTRMLDRLVCKGWIERSPNPNDKRGVLVKLTSDGAEMCEQCHQLVGLTLH
QELTKNLTADEVATLELLLKKILP
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaagcaccagtgacctctttaacgacataattccactgggtcgtcttattcacatg
gtgaatcagaagaaagatcgcctgctcaatgactatctctctccgctggatatcaccgca
acacagttcaaagtgctgtgttccattcgctgcgaagtgtgtatcacgccggttgagctg
aagaaggtgctctctgtcgatctcggtgcgttaacccgcatgctggatcgcctggtctgc
aaggggtggatagaacgtagccctaacccgaatgacaaacgtggcgtactggtgaaactc
accagcgacggcgcggagatgtgtgagcaatgtcatcaattagtaggactaacactgcac
caggaactaacaaaaaacttaacggcagatgaagtggcaacacttgagcttttgcttaag
aaaatactgccgtaa

DBGET integrated database retrieval system