KEGG   Enterobacter cancerogenus: CWI88_17605Help
Entry
CWI88_17605       CDS       T05545                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
ecan  Enterobacter cancerogenus
Pathway
ecan00730  Thiamine metabolism
ecan00790  Folate biosynthesis
ecan01100  Metabolic pathways
ecan02020  Two-component system
Module
ecan_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ecan00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    CWI88_17605
   00790 Folate biosynthesis
    CWI88_17605
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    CWI88_17605
Enzymes [BR:ecan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     CWI88_17605
Exosome [BR:ecan04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CWI88_17605
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ecan00537]
 Enzymes
  CWI88_17605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Phosphodiest Sulfatase
Motif
Other DBs
NCBI-ProteinID: AUJ82763
UniProt: A0A2I6E8T3
LinkDB All DBs
Position
complement(3696457..3697872)
Genome map
AA seq 471 aa AA seqDB search
MKQSALFIALLPLLITPAIHADTLNTQVLDNRAAQGDITQPGGARRLSEDQTAAIRASLN
DKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYALDKKTGKPDY
VTDSAASATAWSTGVKTYNGALGVDIHEKDHQTILEMAKAAGLATGNVSTAELQDATPAA
LVSHVTSRKCYGPSVTSEKCPGNALEKGGKGSITEQLLNARPDVTLGGGAKTFADTATAG
EWQGKTLREQAQARGYQIVSDAASLDAIAEANQDKPLLGLFSEGNMPVRWEGPKASYHGN
IDKPAVTCTPNPKRNDSVPTLAAMTDKAISLLSKNEKGFFLQVEGASIDKQDHAANPCGQ
IGETVDLDEAVQKALAFAKKDGNTLVVVTADHAHASQIIPSDAKAPGLTQALNTKDGAVM
VMSYGNAEEESMEHTGTQLRIAAYGPHAANVVGLTDQTDLFYTMKAALGLK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
ttgaaacagagcgcacttttcatcgcattacttcccctgttaattacccccgctattcat
gccgataccctcaatactcaggtgctggataatcgtgcggctcagggcgatatcacccaa
cccggcggagcacgccgcctttcagaagatcagactgccgctattcgcgcatcgctcaat
gacaagcccgccaaaaatattattctgctgattggcgacgggatgggcgattctgaaatt
actgccgcgcgtaattatgccgaaggggcaggtggattttttaaaggcatcgatgcctta
cccttgaccgggcaatatacccactacgcgctggataaaaaaaccggtaaacccgattac
gtgacagattctgcggcctccgcaacggcatggtcaaccggtgtgaaaacttacaatggc
gcgctgggcgtggatatccacgaaaaagatcatcaaaccattcttgagatggccaaagcg
gcaggtctggcaacgggcaacgtttcaaccgcagagctgcaggatgcgaccccggcggcg
ctggtttcccatgtcacctcgcggaaatgctatggcccgtccgtgaccagcgagaaatgc
ccgggtaacgcgctggaaaaaggcgggaaaggctcgattaccgaacaactgctgaacgcg
cgtccagacgtgacgctgggcggcggtgcgaaaaccttcgcagacaccgcgacagcaggc
gagtggcagggtaaaaccctgcgcgagcaggcgcaggcgcgcggctaccagatagtcagc
gatgcggcctcactggatgcgatcgccgaggcgaatcaggataaaccgctgctgggcctc
ttctctgaagggaatatgccggtgcgctgggaagggccgaaagcctcttaccacggtaac
atcgacaaacctgccgtgacctgcacgcccaacccaaaacgcaatgacagcgtgccgacc
ctggcggcaatgacggacaaagccatctcgctgctgagcaaaaatgaaaaaggcttcttc
cttcaggtagaaggtgcgtcaattgataaacaggatcacgcggccaacccgtgcggccag
attggcgaaacggtcgatctcgacgaagcggtgcagaaggcgctggcgttcgcgaagaaa
gacggtaacaccctggtggtggtcaccgctgaccacgcgcatgccagccagattatcccg
tcagacgctaaagccccgggcctgacccaggcgctgaacaccaaagacggcgcggtgatg
gtgatgagctacggcaacgctgaagaagagtcaatggagcataccggcacccagctgcgc
attgcggcctacggcccgcatgcggccaacgtggtagggctgactgaccagacggatctc
ttctacaccatgaaagcggcgcttggcttgaaataa

DBGET integrated database retrieval system