KEGG   Enterobacter cancerogenus: CWI88_18500Help
Entry
CWI88_18500       CDS       T05545                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ecan  Enterobacter cancerogenus
Pathway
ecan00473  D-Alanine metabolism
ecan00550  Peptidoglycan biosynthesis
ecan01100  Metabolic pathways
ecan01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ecan00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CWI88_18500 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CWI88_18500 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CWI88_18500 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ecan01011]
    CWI88_18500 (ddl)
Enzymes [BR:ecan01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CWI88_18500 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:ecan01011]
 Precursor biosynthesis
  Amino acid ligase
   CWI88_18500 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 CPSase_L_D2 ATP-grasp_3 ATPgrasp_YheCD ATP-grasp TTL ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AUJ82925
UniProt: A0A2I6E995
LinkDB All DBs
Position
complement(3893278..3894198)
Genome map
AA seq 306 aa AA seqDB search
MADKIAVLFGGTSAERDVSLNSGAAVLAGLREGGVDAHPVDPKDVDVTQLKAMGFDKVFI
ALHGRGGEDGTLQGLLDLIGLPYTGSGVMASAISMDKLRSKLLWQGAGLPVAPWVALTRR
EYEMGLNDSVNGRIAALGLPVIVKPSREGSSVGMSKVDKAGDLPAALALAFQHDEEVLIE
KWLSGPEYTVAMLGEEILPSIRIQPAGVFYDYEAKYLSDETQYFCPSGLEDQREADLRAL
VLKAWTVLGCRGWGRIDVMLDGDGQFYLLEANTSPGMTSHSLVPMAARQAGMSFSQLVVR
ILDQAG
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggctgataagattgcggtcctgtttggcgggacatccgctgaacgcgatgtttccctg
aactcaggcgctgccgtactggcgggcctgcgtgaaggcggcgtggatgcgcacccggtc
gatcctaaagacgtggatgtgacgcagctgaaagcgatgggctttgataaggtctttatc
gcgctgcacggccgcggcggtgaagacggcaccctgcaagggctgctggatctcatcggc
ctgccgtacaccggcagcggcgtaatggcctcggcgatctcaatggataaactgcgcagc
aaactgctgtggcagggcgcgggtttacccgttgcgccatgggttgccctgacgcgtcgc
gaatatgaaatgggccttaacgatagcgttaatggacgcattgcggcgctggggttaccg
gttattgttaagccgagccgtgaagggtcgagcgttggtatgtcgaaagtcgataaagcg
ggggatttacccgccgcgttagcactggcatttcaacatgatgaagaagttttaatcgaa
aaatggcttagcgggccagaatataccgtggcgatgctcggtgaagaaattttaccgtca
attcgcatccaacccgctggcgtcttctatgattatgaggcgaagtatctctctgatgag
acgcaatatttttgcccatcaggtttagaagatcaacgtgaggctgatttacgcgctctg
gtgcttaaagcctggactgttttaggctgccggggatggggaagaattgacgtgatgctc
gacggtgacgggcaattttatctgctggaagcgaatacctcgccgggcatgaccagccac
agccttgtgccgatggcggcgcgtcaggcgggcatgagcttctcccagcttgttgtacgc
atactggaccaggcgggctga

DBGET integrated database retrieval system