KEGG   Enterobacter cancerogenus: CWI88_20645Help
Entry
CWI88_20645       CDS       T05545                                 

Gene name
tuf
Definition
(GenBank) elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
ecan  Enterobacter cancerogenus
Brite
Translation factors [BR:ecan03012]
 Eukaryotic Type
  Elongation factors
   CWI88_20645 (tuf)
 Prokaryotic Type
   CWI88_20645 (tuf)
Mitochondrial biogenesis [BR:ecan03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CWI88_20645 (tuf)
Exosome [BR:ecan04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CWI88_20645 (tuf)
  Exosomal proteins of breast cancer cells
   CWI88_20645 (tuf)
  Exosomal proteins of colorectal cancer cells
   CWI88_20645 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: AUJ83321
UniProt: A0A2J7NYJ5
LinkDB All DBs
Position
complement(4324854..4326038)
Genome map
AA seq 394 aa AA seqDB search
MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGAARAFDQIDNAPEEKARG
ITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHI
LLGRQVGVPFIIVFLNKCDMVDDEELLELVEMEVRELLSQYDFPGDDTPIVRGSALKALE
GEAEWEEKIIELAGFLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIIKVG
EEVEIVGIKETAKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREEIERGQVLAKPGSIK
PHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELPEGVEMVMPGDNIKMV
VTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVLG
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
gtgtctaaagaaaaatttgaacgtacaaaaccgcacgtcaacgttggtactatcggccac
gttgaccatggtaaaactaccctgaccgctgcaatcactaccgtactggctaaaacctac
ggcggtgctgctcgtgcattcgaccagatcgataacgcaccagaagaaaaagcgcgtggt
atcaccatcaacacgtcccacgttgaatatgacaccccgactcgccactacgcacacgta
gactgcccaggccacgccgactatgttaaaaacatgatcaccggtgctgcgcagatggac
ggcgcgatcctggttgttgctgcgactgacggcccaatgcctcagactcgtgagcacatc
ctgctgggtcgtcaggtaggcgttcctttcatcatcgtgttcctgaacaagtgcgacatg
gttgatgacgaagagctgctggaactggtagagatggaagttcgtgaactgctgtctcag
tacgatttcccaggcgacgacactccaatcgttcgtggttccgcgctgaaagcgctggaa
ggcgaagcagagtgggaagagaaaatcatcgaactggctggcttcctggattcttacatc
ccagaaccagagcgtgcgattgacaagccattcctgctgccaatcgaagacgtattctcc
atctccggtcgtggtaccgttgttaccggtcgtgtagagcgcggtatcatcaaagttggt
gaagaagttgaaatcgttggtatcaaagagactgctaagtctacctgtactggcgttgaa
atgttccgcaaactgctggacgaaggccgtgctggtgagaacgttggtgttctgctgcgt
ggtatcaaacgtgaagaaatcgaacgtggtcaggttctggcgaagccaggctcaatcaag
ccacacaccaagttcgaatctgaagtgtacatcctgtccaaagacgaaggcggccgtcat
actccgttcttcaaaggctaccgtccacagttctacttccgtacaactgacgtgaccggt
accatcgaactgccagaaggcgtagagatggtaatgccaggcgacaacatcaagatggtt
gtgacgctgatccacccaatcgcgatggacgacggtctgcgtttcgcaatccgtgaaggc
ggccgtaccgttggcgcgggcgttgttgctaaagttctgggctaa

DBGET integrated database retrieval system