KEGG   Enterobacter cancerogenus: CWI88_21260Help
Entry
CWI88_21260       CDS       T05545                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
ecan  Enterobacter cancerogenus
Pathway
ecan00250  Alanine, aspartate and glutamate metabolism
ecan00410  beta-Alanine metabolism
ecan00640  Propanoate metabolism
ecan00650  Butanoate metabolism
ecan01100  Metabolic pathways
ecan01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ecan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CWI88_21260
   00650 Butanoate metabolism
    CWI88_21260
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CWI88_21260
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CWI88_21260
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ecan01007]
    CWI88_21260
Enzymes [BR:ecan01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CWI88_21260
Amino acid related enzymes [BR:ecan01007]
 Aminotransferase (transaminase)
  Class III
   CWI88_21260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AUJ83886
UniProt: A0A2I6EC40
LinkDB All DBs
Position
complement(4451973..4453238)
Genome map
AA seq 421 aa AA seqDB search
MNNKELNDRRLQATPRGIGVMCNFYADKAENATVWDVEGNEYIDFAAGIAVLNTGHRHPA
VIAAIEKQLHAFTHTAYQIVPYEGYVALAERINARVPIDGPAKTAFFSTGAEAVENAVKI
ARAWTRRPGLITFGGAFHGRTFMTMALTGKVAPYKLGFGPFPGSVYHAQFPDHLRGVSSQ
EAIKSVERLFKADIAPDQVAAIILEPVQGEGGFNVAPADFMQALRTLCDTHGILLIADEV
QTGFARTGKLFSMENHCVKPDLITMAKSLAGGMPLSAVSGRAEVMDAPAPGGLGGTYAGN
PLAIAAAHAVLDVIDEEDLCTRAAHLGHHLVEVLNKAKDGCPYIADIRAQGSMVAVEFID
PQTGQPSPEFTREVQDRALQQGLLLLSCGVYGNVIRFLYPLTIPEAQFRKALDIISASLT
R
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
gtgaacaacaaagaactgaatgaccggcgcttgcaggccacgccgcgcggcattggggtg
atgtgtaacttctatgccgataaagccgaaaacgccacggtgtgggacgtcgaaggcaat
gagtacattgatttcgccgccgggatcgcggtgctgaataccggccatcgccatcctgcc
gttatcgccgctatcgaaaaacaactccacgccttcacccataccgcctaccagattgtc
ccgtacgaaggctatgtcgctctggctgagcgcatcaacgcccgcgtgccaatagacggc
ccggccaaaaccgctttcttctctaccggagcggaagcggtggagaacgccgttaaaatc
gcgcgcgcctggacccgtcgccccggcctgattacctttggcggtgcatttcatggccgc
acctttatgaccatggcgctgaccggcaaagtcgccccctacaaactcggcttcggcccg
ttccccggctcggtctatcacgcgcagtttcccgatcaccttcgcggcgtgagttcccag
gaggcaatcaaaagcgttgaacgcctctttaaagcggatatcgcccctgaccaggtggcc
gccattatccttgaacctgtgcagggggagggcgggtttaacgtcgcccccgccgatttt
atgcaggctctgcgcaccctgtgcgacacccacggcattctgctgattgccgatgaggtg
caaaccggctttgcgcgtaccggcaaactgttctcaatggaaaaccactgcgtgaagccg
gacctgatcaccatggcgaaaagcctggcgggcggcatgccgctctcggctgtctctggc
cgcgcggaggtgatggacgcccccgcgccgggcgggctgggcggcacctatgcgggtaac
ccgctggcgattgcggcggcgcatgcggtgctggacgtgattgacgaagaagatctctgc
acgcgggcggcgcacctgggacatcatctggttgaagtgctgaataaagcgaaagacggg
tgtccgtacatcgccgatatccgcgcgcaaggctcgatggtggcggtggaatttatcgat
ccgcagaccgggcagccgtcgccggaattcacccgcgaggtacaggatcgcgccctgcag
caggggctgctgctcctgagctgcggcgtgtacggcaacgtgattcgtttcctctatccg
ctgaccattccggaagcgcagttccgtaaagcgctggatattatttccgcctcgctgaca
cgataa

DBGET integrated database retrieval system