KEGG   Enterobacter cancerogenus: CWI88_22435Help
Entry
CWI88_22435       CDS       T05545                                 

Definition
(GenBank) sulfate ABC transporter substrate-binding protein
  KO
K00123  formate dehydrogenase major subunit [EC:1.17.1.9]
Organism
ecan  Enterobacter cancerogenus
Pathway
ecan00630  Glyoxylate and dicarboxylate metabolism
ecan00680  Methane metabolism
ecan01100  Metabolic pathways
ecan01120  Microbial metabolism in diverse environments
ecan01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ecan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    CWI88_22435
  09102 Energy metabolism
   00680 Methane metabolism
    CWI88_22435
Enzymes [BR:ecan01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.9  formate dehydrogenase
     CWI88_22435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Molybdop_Fe4S4 Molybdopterin TAT_signal Rieske_3
Motif
Other DBs
NCBI-ProteinID: AUJ83645
UniProt: A0A2I6EBA9
LinkDB All DBs
Position
4701639..4702226
Genome map
AA seq 195 aa AA seqDB search
MQVSRRQFFKICAGGMAGTTAAALGFAPGVALAETRQYKLLRTRETRNTCTYCSVGCGLL
MYSLGDGAKNAKASIFHIEGDPDHPVNRGALCPKGAGLVDFIHSESRLKYPEYRAPGSDK
WQQISWEEAFDRIAKLMKEDRDANFIPQNAEGVTVNRWLSTGMLCASASSNETGYLTQKF
TRALGMLAVDNQARV
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtcagcagaaggcagttctttaagatctgcgctggcggtatggcaggcactacg
gcagcggcgctgggctttgccccgggcgtagcgctggcggaaacacggcagtacaaactg
ctgcgcacccgcgaaacccgtaacacctgcacgtattgctccgtcggctgtgggctgttg
atgtatagcctcggcgacggtgcaaaaaacgccaaagcatctatcttccacatcgaaggc
gacccggatcacccggtcaaccgtggtgcgttatgcccgaaaggggccggtctggtggac
tttatccattcggaaagccgcctcaagtacccagaatatcgcgcgcccggctccgacaaa
tggcagcaaatcagctgggaagaggcgtttgaccgcatcgcaaaactgatgaaagaagat
cgcgatgccaactttattcctcagaacgccgagggcgtaacggttaaccgctggctctct
accggtatgctgtgcgcgtctgcttccagcaacgaaaccggctatttaacccagaaattc
acgcgtgcactcggtatgctcgcggtcgacaaccaggcgcgtgtctga

DBGET integrated database retrieval system