KEGG   Enterococcus casseliflavus: ECBG_00766Help
Entry
ECBG_00766        CDS       T02623                                 

Definition
(GenBank) acetyl-CoA carboxylase, biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
ecas  Enterococcus casseliflavus
Pathway
ecas00061  Fatty acid biosynthesis
ecas00620  Pyruvate metabolism
ecas00640  Propanoate metabolism
ecas01100  Metabolic pathways
ecas01110  Biosynthesis of secondary metabolites
ecas01120  Microbial metabolism in diverse environments
ecas01130  Biosynthesis of antibiotics
ecas01200  Carbon metabolism
ecas01212  Fatty acid metabolism
Module
ecas_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:ecas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ECBG_00766
   00640 Propanoate metabolism
    ECBG_00766
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    ECBG_00766
Enzymes [BR:ecas01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     ECBG_00766
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     ECBG_00766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 Oxidored_nitro ATP-grasp_5 ATPgrasp_ST ATP-grasp_4
Motif
Other DBs
NCBI-GeneID: 15141979
NCBI-ProteinID: EEV38497
UniProt: C9A7N6
LinkDB All DBs
Position
1521780..1523144
Genome map
AA seq 454 aa AA seqDB search
MFSKVLIANRGEIAVRIIRACRELGIQTVAVYSEADKEALHTELADEAICIGPAKAADSY
LNVQQILSAAIVTKAEAIHPGFGFLSENSRFAAMCEECNIVFIGPKSETIDAMGNKINAR
RLMIEAEVPVIPGSKGAISDVEEALTIAEEIGYPVMLKAAAGGGGKGIRKVADKEALPHH
FASAQQEAKAAFGNDEMYIEKIIYPARHIEVQVLGDSFGNIIHLGERDCSLQRNNQKVLE
ESPSVVISESKRAELGEAAVRAAQAVGYRNAGTIEFLMADTGEFYFMEMNTRIQVEHPIT
EMVTNIDLVKKQLEVASGEPLGLTQADIKMTGAAIECRINAENPAFNFAPSPGKINNLFL
PSGGLGVRVDSAMYSGYTIPPYYDSMIAKVIVHGENRFEALMKMQRALAELVTDGVITNA
EFQMDLISHPKVIAGDYTTAFLQEEFLPNWTPEQ
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgttttctaaagtattgatcgcaaaccgtggcgaaatcgccgtacgtatcattcgcgct
tgtcgagaattaggtattcaaacggtcgccgtttattcagaagcagataaagaagcgttg
catacagagcttgccgatgaagcgatttgtatcggacctgccaaagcagccgactcttat
ttgaatgtacagcagatcctaagcgctgcgatcgtcacaaaggctgaggcgatccatcct
ggatttggcttcctttcagagaatagccgctttgctgcgatgtgcgaggaatgcaatatc
gtctttattgggccaaagagtgagactatcgatgcaatgggaaacaaaatcaatgcaaga
cgcttgatgatcgaagcagaagtaccggtcattcccggaagcaaaggcgcgatttctgat
gtggaagaagctttaacgatcgctgaagagattggttacccagtcatgctcaaagcagcg
gccggcggtggcggtaaagggatacggaaagttgccgataaagaagcgttgccgcatcat
tttgcttccgcgcagcaagaagcaaaagcagcatttggcaacgatgaaatgtacattgaa
aaaatcatttatcctgctcgacacatagaagtgcaagtgttaggtgattcttttggtaat
attatccaccttggtgaacgcgattgctcgctacaacgcaacaaccaaaaagtgttggaa
gaatccccttctgtggtgatttctgaaagcaagcgagcagaactaggagaagcagcggtg
cgtgccgcacaagcggtagggtatcgtaatgctggcacgatcgagtttttaatggcggac
actggggagttttatttcatggaaatgaacactcgaatccaagtggaacacccgatcacc
gaaatggtgacaaacattgatttagtcaaaaaacaacttgaagtcgctagtggcgaaccg
ttaggtttgacacaagcagacatcaagatgacgggcgcggcgatcgaatgtcggatcaat
gcagaaaatccagccttcaattttgcaccgtcaccaggcaagatcaacaatttgttttta
ccaagcggtggtctaggcgttcgtgtagacagtgccatgtattctggctacacgatccca
ccttattatgattctatgatcgctaaagtgatcgttcacggcgagaaccgtttcgaagcg
ttgatgaagatgcagcgggcgttagccgaattagtgaccgatggtgtcattacgaatgca
gaattccaaatggacttgatcagtcacccgaaagtgattgcgggagactatacaaccgcc
tttttacaagaggaatttttgccaaattggacacctgaacaatag

DBGET integrated database retrieval system