KEGG   Enterococcus casseliflavus: ECBG_00844Help
Entry
ECBG_00844        CDS       T02623                                 

Definition
(GenBank) hypothetical protein
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
ecas  Enterococcus casseliflavus
Pathway
ecas00500  Starch and sucrose metabolism
ecas01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ecas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ECBG_00844
Enzymes [BR:ecas01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     ECBG_00844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70
Motif
Other DBs
NCBI-GeneID: 15142061
NCBI-ProteinID: EEV38575
UniProt: C9A7W4
LinkDB All DBs
Position
1609357..1610823
Genome map
AA seq 488 aa AA seqDB search
MNNKVILQGFEWDLPADSQHWNKLKEMSKEIKEYGFTAIWLPPAYKGTAGSEDVGYGVYD
YYDLGEFDQKGSVPTKYGTKDEYLEAIKALQEQGIEVYADIVFNHLIGADEKEVVPAVKY
NTENRNEPISDEEEIEAWTKFTFPGRQGTYNDYVWTWHNFSGVDYDDRNKDHGIFNFADK
GWENQVDDEMGNYDYLMGCDLDMENPETVEQLNKWGQWYQELTGVDGYRLDAVKHIEFNY
YADWILNRREEKGKPLFVVGEYWSGDLPKLEEYLDSSGNLIYLFDVPLHYNLYEASHSNG
EYDMSQIFAGTLTAAREDYAVTFVDNHDTQVGQSLQSWIDGWFKVHAYSLILLRKAGVPV
VFWGDLFGIPAQEIAPVGDALVHMLKLREKLAFGNQVDYFDDPNCIGWVLTGDYEHELSG
LAVVMTNAQGAEKEMTISAIHGGETFVDILRNNEAKVVLDDTGKGVFPVNDGQVSIYVNE
KLVEKYFS
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgaataacaaagtcattttacaagggttcgaatgggacctgccggcagatagccagcac
tggaacaaattgaaagaaatgagtaaagaaatcaaagagtatggatttaccgcaatttgg
ctgccgcctgcctataaagggacagctgggtccgaagacgttgggtatggtgtctatgat
tattatgatctaggcgaattcgatcaaaaggggtcggtgccaacaaaatatggaacaaag
gatgaatacctagaagccatcaaagcactgcaagaacaaggaatagaggtttatgccgac
atcgttttcaatcacttgattggtgccgatgaaaaagaagtcgttccagcggttaaatac
aataccgaaaaccgtaatgaaccgatcagtgatgaggaagaaatcgaagcttggaccaag
ttcactttcccaggacgtcaggggacgtacaatgattacgtttggacgtggcataatttt
tctggtgtcgattatgatgaccgcaacaaagaccacgggatttttaacttcgctgataag
ggctgggaaaaccaagtggatgatgagatgggcaattacgactacttaatgggttgtgat
ttggacatggaaaatcccgaaacagtggaacaactcaataaatggggccaatggtaccaa
gaactgactggcgttgacgggtatcgactagatgcggtcaaacacattgagttcaactat
tacgcggattggatcttaaaccgacgcgaggaaaaaggcaaaccactatttgttgtcgga
gaatattggtcaggggatctgccaaaattagaagagtatttagattcttcaggaaatttg
atttatttatttgatgtgccattgcactacaatttatatgaagcatctcactcaaatggc
gaatacgatatgagccaaatttttgcaggtacgttgaccgccgctcgcgaagattatgca
gtgacttttgtggataatcatgacacgcaggttgggcaaagtttacaatcttggatagac
ggatggttcaaagtccatgcctattcattgatccttttacgtaaagctggcgtaccagta
gttttctggggggatttatttgggattcccgcccaagaaatcgcccctgtcggggatgcg
ctggtccatatgctgaaacttcgggagaagcttgcattcgggaatcaagtcgattatttc
gatgatcctaattgcattggctgggtattaactggcgattatgaacatgagctttctgga
ttagcggtcgtgatgaccaatgcccaaggagcggagaaagaaatgactatcagtgcgatc
catggtggagagacattcgtggatatattgagaaataatgaagcgaaagttgttttagat
gataccggaaaaggtgttttcccggtcaatgatgggcaagtctcgatttatgtaaatgaa
aaattagtagagaagtactttagttaa

DBGET integrated database retrieval system