KEGG   Enterococcus casseliflavus: ECBG_01102Help
Entry
ECBG_01102        CDS       T02623                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ecas  Enterococcus casseliflavus
Brite
KEGG Orthology (KO) [BR:ecas00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ECBG_01102
Enzymes [BR:ecas01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     ECBG_01102
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 FAD_oxidored HI0933_like DAO AlaDh_PNT_C Thi4 FAD_binding_3 Thioredoxin_4 FMO-like Glutaredoxin K_oxygenase
Motif
Other DBs
NCBI-GeneID: 15142315
NCBI-ProteinID: EEV38833
UniProt: C9A8M2
LinkDB All DBs
Position
complement(1872597..1874126)
Genome map
AA seq 509 aa AA seqDB search
MALDKAIKDQLTQYLAMLESEVVFAATLGEDDSSTKVREFLEEIAEMSPKITIQAVASER
TPSFSINRPGEESGIAFAGLPLGHEFTSFILALLQVSGRPPKIDEALQKRIKAIDKPLHF
ETYVSLTCHNCPDVVQALNIMAVLNPSISHTMIEGGMFKEEIDKKKIMAVPTVFLDGEEF
ASGRQTIEQLLEKAAGPTSKDDFAEKELFDVLVVGGGPAGGSAAIYAARKGINTGMVVET
MGGQVMETLGIENMIGTPYTEGPKLMRQVEEHINEYNVDVMKGQRAKDIRRNDVIEVELE
NGAVLKTKTAILATGARWRNINVPGEKEFKNKGVAYCPHCDGPLFAGKEVAVIGGGNSGI
EAAIDLAGMAKHVYVLEFLPELKADLVLQNRLNTLENVTVITNAATKEIAGSDHVEQLTY
VDRETNGEFTLAVEGVFILIGLMPNTEWLKDRIVLNERNEIVVDKHGATNIEGVFAAGDC
TDSVYKQIITSMGSGATAALGAFDHLIRS
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atggcattagataaggcaatcaaagaccaactgacgcagtatctcgcgatgctagaatca
gaggttgtttttgcggcaactttaggtgaggatgattcttccacgaaagtacgtgaattc
ttagaagaaatcgcagaaatgtcgccaaaaatcactatccaagctgtagcaagtgaacgg
acaccaagcttttcgatcaatcgtcccggtgaagaaagcggcatcgcttttgctggttta
ccgttaggacatgagttcacttcgtttattttagcgttgcttcaagtaagcggtcgtccg
ccgaaaattgacgaagcacttcaaaagcgcatcaaagcgatcgataagccattacatttt
gaaacctatgtcagtttgacctgccataactgtcctgatgttgttcaagcgttaaatatc
atggcagtgctaaatccttccatcagtcacaccatgatcgaaggtgggatgttcaaagaa
gaaattgacaagaaaaaaattatggctgtgccaaccgtctttttagacggtgaagaattt
gcaagcggccgtcaaacgatcgaacagttgttggaaaaagcagctggtccgacgagtaaa
gatgactttgctgaaaaagagcttttcgatgtgttagttgtcggtggcggacctgcaggc
ggaagcgcagcgatttatgcagcgcgtaaaggcatcaatactgggatggtcgtcgaaaca
atgggtggacaagtaatggaaaccctggggatcgaaaacatgatcggtactccttatacc
gaaggaccaaaattaatgcgtcaggtagaagagcacatcaacgaatacaatgtagacgtg
atgaaagggcagcgtgcgaaagatattcgtcgcaatgatgtcatcgaagttgaattagaa
aatggtgcagtattaaaaaccaaaacggccattttagcaactggcgctcgctggcgtaac
atcaatgttccaggagaaaaagaattcaaaaataaaggtgttgcctattgcccccattgt
gacggtccgttatttgctgggaaagaggttgctgtcattggcggcggaaactctgggatc
gaagcagcgatcgatttagctggcatggcaaaacacgtctatgttcttgaatttttaccg
gaactaaaagcggaccttgtgctacaaaaccgtttgaacacgttagaaaatgtgactgtt
attacgaatgcggcaacgaaggaaattgctggatccgatcatgtcgaacaattgacctac
gttgatcgcgaaacgaatggcgaattcacattagctgttgagggtgtcttcatcttgatt
ggcttgatgccgaataccgaatggttaaaagatcgcatcgttttaaacgaacgcaatgag
atcgtcgtagacaaacacggcgcaaccaatattgaaggggtctttgcagcaggggattgt
accgatagtgtatacaaacagatcatcacttcaatgggttcaggtgccactgcggcatta
ggtgcctttgatcacctgattcgctcgtaa

DBGET integrated database retrieval system