KEGG   Enterococcus casseliflavus: ECBG_01220Help
Entry
ECBG_01220        CDS       T02623                                 

Definition
(GenBank) thiol reductant ABC exporter, CydC subunit
  KO
K16012  ATP-binding cassette, subfamily C, bacterial CydC
Organism
ecas  Enterococcus casseliflavus
Pathway
ecas02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ecas00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ECBG_01220
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ecas02000]
    ECBG_01220
Transporters [BR:ecas02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC-BAC subgroup
    ECBG_01220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran ABC_membrane SMC_N AAA_21 DUF87 AAA_29 AAA_22 MMR_HSR1 RsgA_GTPase AAA_24
Motif
Other DBs
NCBI-GeneID: 15140674
NCBI-ProteinID: EEV38951
UniProt: C9A8Z0
LinkDB All DBs
Position
79550..81307
Genome map
AA seq 585 aa AA seqDB search
MNKIGLLRSLKTDTWVKPFLSKYKNVLALALFLGFLTFFCGGALMFNSGYLISRSASIPE
NILLVYIPIVLTRAFGIGRPVFRYLERLTSHSWVLRMTSNLRLKLYNVVEKDAIFFKQAH
RTGDILGLLAEDINHIQNLYLRTIFPTVIAWILYAFLIIGLGYFSWWFALVMLLLLGIIV
FVLPLWSVIINGARQEKQKHMKNNLYTTLTDNVLGVSDWVFSQRGSEYVAAHKELETQLR
AVDEQMLSFDRRRDFLLQSIFGVIAVALLLWTSIRFPGNHGGAANWIAAFVLCVFPLVDA
FAPLPSAAQETNRYKDSIDRFNALPEENRQVSMEQPSVPEVTGLVSITVKDLHFQYPEGK
EVLHGLDLTIPAHQKLAILGRSGSGKSTFASLLRGDLQPTQGSITLNDVPVTALSESISD
LIGVINQSPYLFHTTVLNNIRLGNESASEEEVWRVLEQVGLKEMVAALPNGLATMVDEAG
LRFSGGERHRLALARILLKDTPIILLDEPTVGLDPITEQGVLETFFQVLENKTIIWITHH
LQGISMMDRVLFIEDGQLTMSGTPAELAAENKQFQHLLAIDQGRR
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
ttgaataaaatcggcttattgcgctcattgaaaactgatacgtgggtcaagcctttcttg
tcaaaatacaaaaacgttttggcgctggccttattcctaggcttcttgacctttttctgt
ggtggggcactgatgtttaattctgggtacctgatcagccgctcggcatcgatcccagaa
aacattctattggtttacatccccatcgtactgacccgagcgtttgggatcggccgtcca
gtctttcgctatttggaacggttgaccagtcatagctgggtcttgcgcatgacctctaat
ttgcgattgaaattgtacaacgtagtagaaaaagatgcgatcttctttaagcaagcgcat
cgcacgggggatatcttgggcttattggcagaagatatcaaccatattcaaaacctgtat
ttgcggacgatctttcctaccgtgatcgcttggatcttgtatgcgttcttgatcattgga
ctcggctatttttcttggtggtttgctttggtgatgctgctgctattagggatcatcgtc
tttgtcttgccgctttggtcggtgatcatcaacggcgcgcggcaagaaaagcaaaaacac
atgaaaaacaacttgtatacgacactgacggataatgtattaggtgtttctgattgggtc
ttctctcaaagaggcagcgagtacgtggctgcccataaggaactggaaacgcagttgcgg
gcggtggatgaacagatgctgtcctttgatcgccggcgtgattttcttttacaaagcatc
tttggagtgatcgctgtcgcattgctgctttggaccagcattcgctttccaggtaaccac
ggaggagcagccaactggatcgctgcctttgtcctgtgtgtctttcctttagttgatgca
tttgcgccattaccgtcagctgctcaagaaaccaatcgctacaaagactctatcgatcgc
ttcaatgcattaccagaagaaaatcgccaagtctccatggagcaaccgtcagtacctgaa
gtgacgggcctcgtgtcgatcacagtcaaggacttgcattttcagtatcctgaaggcaaa
gaagtgcttcatgggttggatttaacgattcctgcgcatcaaaaactagcgatccttggt
cgcagcggttctgggaaaagtacatttgcctccttgttgcgaggcgatctgcaaccgacg
caagggtcgatcaccttaaacgacgtgcctgtgacggcattgagtgagtcgatcagtgac
ttgatcggtgtcatcaatcaaagtccctatcttttccatacgaccgtcttgaataatatt
cggctaggcaatgagtcggcttcggaagaagaagtctggcgcgtactggagcaagtcggg
ttgaaagaaatggtggcagctttgcctaacggcttggcgacgatggtggatgaagccggc
ttgcgtttttctggtggagaacgccatcgtttggccttggcgcggatcttgctaaaagat
actccgatcatcttattggatgagccaaccgtcggcttagacccgattacggagcaaggc
gtgctcgaaacctttttccaagtgctggagaacaaaacgatcatttggatcacccaccac
ttgcaaggaatttcgatgatggaccgtgtgctctttattgaagatggtcagttgaccatg
agcggaacacctgccgaattggcagcagaaaacaaacaatttcaacacttattggccatt
gaccaaggacgacgataa

DBGET integrated database retrieval system