KEGG   Enterococcus casseliflavus: ECBG_03079Help
Entry
ECBG_03079        CDS       T02623                                 

Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ecas  Enterococcus casseliflavus
Pathway
ecas00250  Alanine, aspartate and glutamate metabolism
ecas00430  Taurine and hypotaurine metabolism
ecas00650  Butanoate metabolism
ecas01100  Metabolic pathways
ecas01110  Biosynthesis of secondary metabolites
ecas01120  Microbial metabolism in diverse environments
ecas02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:ecas00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ECBG_03079
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ECBG_03079
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ECBG_03079
   00430 Taurine and hypotaurine metabolism
    ECBG_03079
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    ECBG_03079
Enzymes [BR:ecas01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     ECBG_03079
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-GeneID: 15143620
NCBI-ProteinID: EEV40810
UniProt: C9AD51
LinkDB All DBs
Position
complement(3242505..3243899)
Genome map
AA seq 464 aa AA seqDB search
MLFSKKNRKEAQYLEPIYGNEAMDRAIPMYKLPKESLVPRDAYELVKDQLIDEGVSRQNL
ATFCQTYMEPEAVKIMSETLDKNAIDKTEYPRTAEIENRCVNMIADLWHAPEASDFIGTS
TVGSSEACMLGGLALKFAWRNRAKKLGLDINKRKPNLVISSAYQVVWEKFCVYWDVEMRT
IPIDEEHGSINVEKVTDYLDEYTIGVVGILGITYTGRYDDIKALDKKLEEYNKHTDYKVY
IHVDAASGGLYTPFMEPELEWDFRLKNVRSISTSGHKYGLVYPGIGWVLWKEKDFLPEEL
VFKVSYLGGEMPTMAINFSRSASQIIGQYYTFIRNGFEGYRLIHKKTSDVAQYLAKEIEN
MGYFDIYNDGSRLPIVCYKLKENADISWNLYDLTDEFAMKGWQVPTYPLPDNLSHINIQR
FVCRADLSMQMAMDLVQDMKEGIERLNKRPTRHVSSDQTYGFSH
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgttatttagtaaaaaaaatcgaaaagaagcccaatatttggaacctatctatgggaat
gaggcaatggatcgggcaatccctatgtacaaattaccaaaagagtctttggtaccgcgg
gatgcctatgaattagtcaaagatcaattgatcgatgaaggggtctcaagacaaaatttg
gcgacgttttgtcaaacctacatggaaccagaagcagtcaaaatcatgagtgaaaccctt
gataaaaacgccatcgataaaaccgagtacccacggacagcagaaattgaaaaccgctgt
gtcaacatgatcgctgatttatggcatgcgccagaagcgtctgattttatcggtacatca
acggtaggctcaagtgaagcgtgtatgctaggtggattggccttaaaatttgcttggcgc
aatcgggcaaaaaaacttggcttagatatcaataaacgaaaaccaaacttagtgatttct
tctgcctatcaagtcgtttgggaaaaattctgtgtctactgggacgttgaaatgcggacg
attcctatcgatgaagaacatggcagcatcaatgtcgaaaaggtcacggactatttagat
gaatatacgatcggggtcgtcggtatcttagggatcacttacactggacgatacgatgat
atcaaagcactagacaagaaattagaggaatacaacaaacacaccgactacaaagtttat
atccacgtggatgcggctagtggtggattgtacacaccatttatggaaccagagcttgaa
tgggatttccgtttgaaaaacgttcgttccatcagtacgtctggacataaatatgggtta
gtctatcctggtatcggttgggtgctttggaaagaaaaagattttctaccagaagagttg
gtctttaaagtaagttatcttggcggtgaaatgccaacgatggccatcaacttttcaaga
agtgccagccaaatcatcggacaatattacacctttatccgcaatggatttgaaggctac
cgcttgatccacaaaaagacgagtgatgttgcccaatatttagcaaaagagattgaaaac
atgggttacttcgatatttataatgatgggtcacggttgccgatcgtctgctacaaatta
aaagaaaatgccgacatttcttggaatctgtatgatttgacggatgaatttgcgatgaaa
ggctggcaagtccctacctatccattacctgataatctatcacatatcaatatccaacgg
tttgtctgtcgggcagatttaagtatgcaaatggcaatggatctggtgcaagacatgaaa
gaaggaatcgagcgcttgaacaagcgaccaacccgtcatgtttcatctgatcaaacctat
ggcttttcacattaa

DBGET integrated database retrieval system