KEGG   Equus caballus (horse): 100009697
Entry
100009697         CDS       T01058                                 

Gene name
ITGA2B
Definition
(RefSeq) integrin alpha-IIb precursor
  KO
K06476  integrin alpha 2B
Organism
ecb  Equus caballus (horse)
Pathway
ecb04015  Rap1 signaling pathway
ecb04151  PI3K-Akt signaling pathway
ecb04510  Focal adhesion
ecb04512  ECM-receptor interaction
ecb04611  Platelet activation
ecb04640  Hematopoietic cell lineage
ecb04810  Regulation of actin cytoskeleton
ecb05165  Human papillomavirus infection
ecb05200  Pathways in cancer
ecb05222  Small cell lung cancer
ecb05410  Hypertrophic cardiomyopathy
ecb05412  Arrhythmogenic right ventricular cardiomyopathy
ecb05414  Dilated cardiomyopathy
ecb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    100009697 (ITGA2B)
   04151 PI3K-Akt signaling pathway
    100009697 (ITGA2B)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100009697 (ITGA2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100009697 (ITGA2B)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100009697 (ITGA2B)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100009697 (ITGA2B)
   04611 Platelet activation
    100009697 (ITGA2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100009697 (ITGA2B)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100009697 (ITGA2B)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100009697 (ITGA2B)
   05410 Hypertrophic cardiomyopathy
    100009697 (ITGA2B)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100009697 (ITGA2B)
   05414 Dilated cardiomyopathy
    100009697 (ITGA2B)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100009697 (ITGA2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ecb01009]
    100009697 (ITGA2B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100009697 (ITGA2B)
   04515 Cell adhesion molecules [BR:ecb04515]
    100009697 (ITGA2B)
   04090 CD molecules [BR:ecb04090]
    100009697 (ITGA2B)
Protein phosphatases and associated proteins [BR:ecb01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100009697 (ITGA2B)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100009697 (ITGA2B)
Cell adhesion molecules [BR:ecb04515]
 Integrins
  Integrin alpha subunits
   100009697 (ITGA2B)
CD molecules [BR:ecb04090]
 Proteins
  100009697 (ITGA2B)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha
Other DBs
NCBI-GeneID: 100009697
NCBI-ProteinID: NP_001075262
UniProt: Q7YRP8
LinkDB
Position
11
AA seq 1036 aa
MARALRPLHALWLLEWMQLLLGPGTAPQAWALNLDPVRLTFYTGPNGSHFGFSLDFYKDS
RGSVSIVVGAPRTLGRSQEEMGGAFLCPWKAEGGQCTSLSFDLNDETRNTSSQIFQTFKA
QQGLGASVVSWSDYVVACAPWQHWNALEKTDEAEKTPVGGCFVAQLENGRRAEYSPCRDN
IMSHVYSKTYLGDKRYCEAGFSSAVTQAGELVLGAPGGYYFLGLLARAPIANIVSSYRPG
TLLWSVPTQRFTFDSMKPEYFDGYRGYSVAVGEFDEDLSTTEYVFGAPTWSWTLGAVEIL
DSNFQMLHRLHGEQMASYFGHSVAVTDVNGDRRHDLLVGAPLYMERRADRKLAEVGRVYL
FLQPRSPQPLGPASLLLTGTRIYGRFGSAIAPLGDLNRDGYNDVAVAAPYGGPDGRGQVL
VFLGQSEGLSSHPSQVLDSPFSTGSAFGFSLRGATDIDDNGYPDLLVGAYGANKVAVYRA
QPVVMVSVQLLVNDSLNPAVKNCVLPQKKTSVSCFDIQMCVGVTGHNIPEKLRLNAELQL
DRQKPRQGRRVLLLSSQQAGTTLHLDLGGRTSPNCRTIEAFLRDEADFRDKLSPIVLSLN
VSLQPEKDGIAPALVLHGDTHVQEQTRIILDCGEDDLCVPQLHLTANVTGSPLLIGADNV
LKLQMDATNEGEGAYEAELAVQLPPGAHYMQALSNIEGFERLICDQKKENETKVVLCELG
NPMKRNAQIEITMLVSVENLEEAGETVSLQLQIRSKNSKNPNSETLRLHVPVRAEARVEL
RGNSLPASLVVAAEEDDRKNSSDSWGPKVEHTYELHNNGPGAVRGLRLSLHLPSQSQPSD
LLYILDIQPQGGLQCSPQPSPNPLKLDWGLPTPSPSPVYHPRHQRERREAFLPGPMQPSR
LQDPVLVNCDSAPCTVVQCELEEMARGQRAMVTVRAFVWLPSLRQKLLDQFVLQSRAWFN
VSSLPYAVPTLSLPSGEALVQTQLLRVLEDRAIPIWWVLVGVLGGLLLLTLLVVAMWKVG
FFKRNRPPLEEDEEDE
NT seq 3111 nt   +upstreamnt  +downstreamnt
atggccagagctttgcgtccacttcatgccctctggcttctggagtggatgcagctgctc
ttgggacccggtacagcccctcaagcctgggccttgaacctggacccggtgcggctcacc
ttctacacaggccccaatggcagccactttgggttttcactggacttctacaaagacagc
cgtgggagcgtgtccatcgtggtgggcgccccgcggaccctaggccgcagccaggaggaa
atgggcggcgctttcctgtgcccctggaaggccgagggcggccagtgcacctcgctgtcc
ttcgacctcaatgatgagacgcgaaacacaagctcccaaattttccaaacctttaaggcc
cagcaaggactgggggcgtcggtcgtcagctggagcgactacgttgtggcctgcgccccc
tggcagcactggaacgccctggaaaagaccgacgaggctgagaagacgccggtaggtggc
tgcttcgtggctcagctcgagaacggccgccgcgcggagtactcgccctgtcgggacaac
atcatgagccatgtttacagcaaaacctacttgggagacaagcgctactgcgaagccggc
ttcagctcggcggtcactcaggctggggagctggtgcttggggcccctggcggctattat
ttcttaggtctcctggcgcgggctccaattgccaatatcgtctcgagttaccgcccgggc
accctcttatggagcgtgcccacccagcgcttcacattcgattccatgaaaccagagtac
ttcgacggctaccgggggtactcagtggccgtgggcgagttcgatgaagatctcagcact
acagagtatgtcttcggtgcccccacctggagctggaccctgggagcggtggaaatttta
gactcgaacttccagatgctgcaccggctacatggagagcagatggcttcgtatttcggg
cattcggtggctgtcactgacgttaacggggacaggaggcacgacctgctggtgggcgca
ccactgtacatggaaagacgtgctgaccgcaagctggcggaggtggggcgcgtgtacttg
ttccttcagcctcgaagcccccaaccgctgggccccgccagcctcctgctgaccggcaca
cggatctatggacgatttggctcggccatcgctcctctgggcgacctcaaccgagatggc
tacaatgatgttgcagtggccgccccctatggtggtcccgatggtcggggccaagtgctg
gtgttcctgggtcagagtgaggggcttagctcacacccctcccaggtcctggacagcccc
ttctccacaggctctgccttcggcttctcccttcgaggtgccacagacatcgatgacaat
ggatatccagacctattggtgggagcttacggggccaacaaggtggctgtgtacagagct
cagccggtggtgatggtcagtgtccagctgctagtgaacgattcgctgaatcctgctgtg
aagaattgtgtgctgccccagaaaaagacatcagtgagctgctttgacatccagatgtgt
gtgggagtcactgggcacaacattcctgagaagctgcgcctaaatgccgaactgcagctg
gaccggcagaagccccgccagggccggcgggtgctactgctgagctctcaacaggcaggc
accacgctgcacctggacctgggcgggaggaccagccccaactgccgcaccatcgaggcc
ttcctccgagatgaggctgacttccgggacaagctgagccccatcgtgctcagcctcaat
gtgtccctgcagcccgagaaggatggaatagcccctgctctcgtgctgcatggagacacc
cacgttcaggagcagacccgcatcatcctggactgtggggaagacgacctgtgtgtgcct
cagcttcacctcactgccaacgtgacgggctccccactcctaattggagccgataatgta
ctgaagctgcagatggatgccaccaacgagggtgagggggcctatgaggctgaactggcc
gtgcagctgcccccaggtgcccactacatgcaggccctcagcaacatagagggctttgag
aggctcatctgtgaccagaagaaggagaacgagaccaaggtggtgctgtgtgagctgggc
aaccccatgaagaggaatgcccagatagaaatcacgatgttggtgagtgtggagaacctg
gaagaagctggggagactgtgtccttgcagttgcagataaggagcaagaacagcaagaat
ccgaacagcgagactctgcggctgcatgtacctgtccgggcggaggcccgcgtggagctg
cgagggaactcccttccagcctccctagtggtggcagcagaagaagatgacaggaagaac
agctcagacagctggggtcccaaagtggagcacacctatgagctccacaacaatggccct
ggtgctgtacgtggcctgcgcctcagcctccacctcccgagccagtcccagccctctgac
ctgctctacatcctggatatacagccccagggggggcttcagtgctccccacagccgtct
cctaaccccctcaagctggactgggggctgcccacccccagcccttcccctgtttaccac
ccccgtcaccagcgggagcgcagagaggcattcctgccagggccaatgcagccctcgagg
cttcaggacccagttctcgtgaactgcgactcggcgccctgtactgtggtgcagtgtgag
ctggaggagatggcgcgtgggcagcgggccatggtcaccgtgcgggcctttgtgtggctg
cccagccttcgccagaagctactggatcagtttgtgctacagtcacgcgcttggttcaac
gtctcctcccttccgtatgccgtgcccaccctcagcctgcccagcggggaagctctggtg
cagacgcagctgcttcgggtcttggaggacagggccattccaatctggtgggtgctggta
ggcgtgctgggtggcctgctgttgctcaccctcctggtcgtggccatgtggaaggtcggc
ttcttcaagcggaatcggccaccgctggaagaagatgaagaagatgagtga

KEGG   Equus caballus (horse): 100056202
Entry
100056202         CDS       T01058                                 

Gene name
ITGA3
Definition
(RefSeq) integrin alpha-3 isoform X1
  KO
K06482  integrin alpha 3
Organism
ecb  Equus caballus (horse)
Pathway
ecb04151  PI3K-Akt signaling pathway
ecb04510  Focal adhesion
ecb04512  ECM-receptor interaction
ecb04640  Hematopoietic cell lineage
ecb04810  Regulation of actin cytoskeleton
ecb05165  Human papillomavirus infection
ecb05200  Pathways in cancer
ecb05222  Small cell lung cancer
ecb05410  Hypertrophic cardiomyopathy
ecb05412  Arrhythmogenic right ventricular cardiomyopathy
ecb05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100056202 (ITGA3)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100056202 (ITGA3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100056202 (ITGA3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100056202 (ITGA3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100056202 (ITGA3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100056202 (ITGA3)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100056202 (ITGA3)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100056202 (ITGA3)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100056202 (ITGA3)
   05414 Dilated cardiomyopathy
    100056202 (ITGA3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100056202 (ITGA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100056202 (ITGA3)
   04515 Cell adhesion molecules [BR:ecb04515]
    100056202 (ITGA3)
   04090 CD molecules [BR:ecb04090]
    100056202 (ITGA3)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100056202 (ITGA3)
Cell adhesion molecules [BR:ecb04515]
 Integrins
  Integrin alpha subunits
   100056202 (ITGA3)
CD molecules [BR:ecb04090]
 Proteins
  100056202 (ITGA3)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS
Other DBs
NCBI-GeneID: 100056202
NCBI-ProteinID: XP_014596552
Ensembl: ENSECAG00000015760
VGNC: 19164
UniProt: F6W8D8
LinkDB
Position
11
AA seq 1066 aa
MGPGPSRAARVPRPMLCALALMVAAGGRVASAFNLDTRFLVVKEAQNPGSLFGYSVALHR
QTELQHRYLLLAGAPRDLAVPDGYTNRTGAVYLCPLTAHKDDCERMDIKEKSDPTHHIIE
DMWLGVTVASQGPAGRVLVCAHRYTQVLWSGSEDQRRMVGKCYVRGNDLKLDPTDDWQTY
HNEMCNSNTDYLETGMCQLGTSGGFTQNTVYFGAPGAYNWKGNSYMIQRKDWDLSEYSYK
EPKDQGNLYIGYTVQVGSAILHPTDITIVTGAPRHQHMGAVFLLSQEAGGDLRRRQVLEG
TQVGAYFGSAIALADLNNDGWQDLLVGAPYYFERKEEVGGAIYVFMNQAGTSFPAHPSLL
LHGPSRSAFGFSVASIGDINQDGFQDIAVGAPFEGLGKVYIYHSSSRGLLRQPQQVIHGE
KLGLPGLATFGYSLSGQMDVDDNFYPDLLVGSLSDRIVLLRARPVINILHRTLVARPSVL
DPALCTATSCVQVELCFAYNQSAGNPNYRRNITLAYTLEADRDRRPPRLRFARSQSAVFH
GFFSMPEMRCQTLELLLMDNVRDKLRPIMISMNYSLPLRMPERPRLGPRSLDAYPVLNQA
QALENHTEVQFQKECGQDNKCDSNLQMRAAFVSEQGQRLSRLQYSRDVRKLLLSINVTNP
QSQERAGEDAHEALLTLLVPPALLLSSVRPPGACQANETILCELGNPFKRNQRMELLIAF
EVIGVTLHTRELQAQLQLSTSSHQDDLWPVTLTLLVDYTLQASLSMVSHRLQSFFGGTVM
GESGMKTVEDVGSPLKYEFQVGSMGEGLTALGTLVLGLEWPYEVINGKWLLYPTAITIHG
NGSWPCQPPGDLVNPLNLTLSVLGDRPPFPQRRRRQLDPGGGQGPPPVTLAAAKKAKSET
LLSCGSDLTRCVWLECPIPEAPLITNVTVQARVWNSTFIEDYRDFDRVRVASWATLFLRT
SVPTINMENKTVGFSVDIDSDLVEELPAEIELWLVLVAVSAGLLLLGLIILLLWKCDFFK
RTRYYRIMPKYHAVRIREEERYPPPGSTPPTKKHWVTSWQTRDRYY
NT seq 3201 nt   +upstreamnt  +downstreamnt
atgggccccggccccagccgcgccgcccgcgtcccgcgcccgatgctctgcgcgctcgcc
ttgatggtggccgccggcggccgcgtcgcctccgccttcaacctggacacccgattcctg
gtggtgaaggaggcccagaacccgggcagcctcttcggctactcggtcgccctccatcgg
cagacggagctgcagcatcgctacctgctcctggctggtgccccccgggacctcgccgtg
cctgatggctataccaaccggaccggtgccgtgtacctgtgtccactcactgcccacaag
gacgactgtgagcggatggacatcaaggagaaaagtgaccctacccatcacattattgag
gacatgtggcttggagtgactgtggccagccagggccctgcaggcagagtcctggtctgt
gcccaccgctacacccaggtcctgtggtcagggtcggaggaccagcggcgcatggtgggc
aagtgctatgtgcggggcaacgacctgaagctggaccccactgatgactggcagacctac
cacaacgagatgtgcaacagcaacaccgactacctggagacgggcatgtgccagctgggc
accagcggcggcttcacccagaacactgtgtacttcggcgctcctggtgcctacaactgg
aaaggaaacagctatatgattcagcggaaggactgggatttgtctgaatacagttacaag
gagcccaaggaccaaggaaacctctacattgggtacacggtgcaggtgggcagcgcaatc
ctgcatcccacggacatcaccattgtgacaggtgccccgcggcaccaacatatgggtgct
gtcttcttgctgagccaggaggcaggcggagacctgcggaggaggcaggtgctggagggc
acgcaggtgggcgcctattttggcagcgccattgccctggcagacctgaacaatgatggg
tggcaggacctcctggtgggtgctccctactactttgagcggaaggaggaggtagggggt
gccatctatgtcttcatgaaccaggcaggcacttcctttcctgcccacccctccctcctt
cttcacggccccagtcgctccgccttcggcttctccgtggccagcattggtgacatcaac
caggatggattccaggacattgctgtaggagccccgttcgagggcttgggcaaagtgtac
atctaccacagcagctccagggggctcctcagacagccccagcaggtaatccacggagag
aagctgggactgcctggcttggccaccttcggctattccttgagtgggcagatggacgtg
gatgacaacttctacccagacctgctagtggggagcctgtctgaccgcatcgtgctgctg
cgggcccggcctgtcatcaacatcctccacaggaccttggtggccaggccatctgtgctg
gaccctgcactctgcacggccacctcctgtgtgcaggtggagctgtgctttgcttacaac
cagagtgccgggaaccccaactacaggcgaaacatcaccctggcctacactctggaggcc
gaccgggaccgccgtccaccccggcttcgctttgcacgcagccagtcagctgtcttccac
ggcttcttctccatgcccgagatgcgctgccagacgctggagcttctcctgatggacaac
gtccgcgacaaactccgtcccatcatgatctccatgaactactctttacctttgcggatg
cccgagcgcccccggctggggccgcggtccctggacgcctatccagtcctcaaccaggcg
caggctctggagaaccacacggaggtccagttccagaaggagtgcgggcaggacaacaag
tgcgacagcaacttgcagatgcgagcggccttcgtgtcagagcagggacagcggctgagc
aggctccagtacagcagagatgtccggaaactgctcctgagcatcaatgtgaccaacccc
cagagccaggagcgggctggggaagacgcccatgaggcgctgctcaccctattggtgcct
cccgccctgctgctgtcctccgtgcgccctcctggggcctgccaggccaacgagaccatc
ctttgcgagctggggaaccccttcaaacggaaccagaggatggagctgctcatcgccttc
gaggtcatcggggtgaccctgcacacaagggagctccaggcacagctgcaactctccacg
tccagtcaccaggacgacctgtggcccgtgaccctgactctgctagtggactacacgctc
caggcctcgctcagcatggtgagtcaccggctacaaagcttctttggggggacagtaatg
ggcgagtctggcatgaaaactgtggaggatgtgggaagccctctcaagtatgagttccag
gtgggctccatgggggaagggctgacagccctggggaccttggtcctagggctggaatgg
ccctatgaagtcatcaatggcaaatggctgctgtaccccactgcgatcaccatccacggc
aatgggtcctggccctgccagccacctggagacctcgtcaaccctctcaacctcactctt
tctgtccttggggacagaccgccatttccacagcgcaggcggcgacagctggacccaggg
ggaggccagggccccccgcctgtcactctggctgctgccaaaaaagccaagtctgagacc
ctgctgagctgtggcagtgacctcacccgctgtgtgtggctggagtgccccattcctgag
gctcctcttatcaccaacgtgaccgtgcaggcacgagtgtggaacagcaccttcatcgag
gactacagagactttgaccgagtcagggtggccagctgggctaccctgttcctccgaacc
agcgtccccaccatcaacatggagaacaagactgtggggttctccgtggacatcgactct
gacctggtggaggagctgccggctgagatcgagctgtggctggtgcttgtggctgtgagt
gccgggctgctgctcctagggctgatcatcctcttgctgtggaagtgtgacttctttaag
cggacccgctattaccggatcatgcccaagtaccatgcagtgcggatccgggaggaagag
cgctacccgcctccagggagcaccccgcccaccaagaagcactgggtgaccagctggcag
actcgggaccgatactactga

KEGG   Equus caballus (horse): 100063367
Entry
100063367         CDS       T01058                                 

Gene name
ITGA2
Definition
(RefSeq) integrin alpha-2
  KO
K06481  integrin alpha 2
Organism
ecb  Equus caballus (horse)
Pathway
ecb04145  Phagosome
ecb04151  PI3K-Akt signaling pathway
ecb04510  Focal adhesion
ecb04512  ECM-receptor interaction
ecb04611  Platelet activation
ecb04640  Hematopoietic cell lineage
ecb04810  Regulation of actin cytoskeleton
ecb05165  Human papillomavirus infection
ecb05200  Pathways in cancer
ecb05205  Proteoglycans in cancer
ecb05222  Small cell lung cancer
ecb05410  Hypertrophic cardiomyopathy
ecb05412  Arrhythmogenic right ventricular cardiomyopathy
ecb05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100063367 (ITGA2)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100063367 (ITGA2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100063367 (ITGA2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100063367 (ITGA2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100063367 (ITGA2)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100063367 (ITGA2)
   04611 Platelet activation
    100063367 (ITGA2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100063367 (ITGA2)
   05205 Proteoglycans in cancer
    100063367 (ITGA2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100063367 (ITGA2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100063367 (ITGA2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100063367 (ITGA2)
   05414 Dilated cardiomyopathy
    100063367 (ITGA2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100063367 (ITGA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100063367 (ITGA2)
   04515 Cell adhesion molecules [BR:ecb04515]
    100063367 (ITGA2)
   04090 CD molecules [BR:ecb04090]
    100063367 (ITGA2)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100063367 (ITGA2)
  Exosomal proteins of bladder cancer cells
   100063367 (ITGA2)
Cell adhesion molecules [BR:ecb04515]
 Integrins
  Integrin alpha subunits
   100063367 (ITGA2)
CD molecules [BR:ecb04090]
 Proteins
  100063367 (ITGA2)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 FG-GAP_2 VCBS Integrin_alpha HisK_sensor
Other DBs
NCBI-GeneID: 100063367
NCBI-ProteinID: XP_005604336
Ensembl: ENSECAG00000010739
VGNC: 19163
LinkDB
Position
21
AA seq 1179 aa
MRPGRTGGAPLRLVLVLSQGILNCCMAYNVGLPEAKIFSGPSSEQFGYAVQQFLNPKGNW
LLVGSPWSGFPENRMGDVYKCPVDLSTATCEKLNLQTSTSIPNVTEMKTNMSLGLTLTRN
VGTGGFLTCGPLWAQQCGSQYYTTGVCSDVSPDFQLLASFSPAAQTCPSLIDVVVVCDES
NSIYPWEAVKNFLEKFVQGLDIGPTKTQVGLIQYANNPRVVFNLNTFKTKAEMVEATSQT
FQFGGDLTNTFKAIQYARDSAYSAAAGGRRGATKVMVVVTDGESHDGSMLKAVIDQCNSD
NILRFGIAVLGYLNRNALDTKNLIKEIKAIASIPTERYFFNVSDEVALLEKAGTLGEQIF
SIEGTVQGGDNFQMEMSQVGFSADYSPQNDILMLGAVGAYGWSGTVVQESSHGHLIFPKQ
AFDQILHDRNHSSYLGYSVAAISTGKGVHFVAGAPRANYTGQIVLYSVNENGNITIIQTH
RGDQIGSYFGSVLCSVDVDKDAITDVLLVGAPTYMNDLKKEEGRVYLFTITKGILNWHQF
LEGPDGVENARFGSAIAALSDINMDGFNDVIVGSPLENQNSGAVYIYNGHEGTIRLKYSQ
KILGSDGAFRSRLQYFGRAVDGHEDLNGDSITDVSVGAFGQVVQLWSQSIADVSVDASFT
PEKITLFNKNAEISLKLCFSAKFRPTKQNSQVAITYNITLDADLYSSRVTSRGLFKENNE
RYLRKNMIVSQAQNCSEYIIHIQEPSDVVNSLGLCVNISLENPGTSPALEAYSETAKVFS
IPFHKDCGDDGICISDLVLHVQQLPASQEQPFIVSNQNKRLTFSVTLKNKKESAYNAGIV
VDFSENLFFASWSMPVDGTEVTCQVASSQKSVTCDVGYPALKRKQKVTFTINFDFNLQNL
QNQASVSFQAMSESHEENKADNSANFKIPLLYDADIHITRSTNINFYEVSSDGNVSSIVH
NFEDIGPKFIFSIKVTTGSVPVSMASVIIHIPQYTKEKNPLMYLTGVDTDQAGDISCNAE
INPLKIGQTLSSVSFKSENFRHIKELNCRTASCRNVTCWLTDLQMKSEYFLNVSTRIWNG
TFAASTFQTVQLTAPAEIDTYNPQIYVIEENTVTIPITIMKPHEKAEVPTGVIVGSVIAG
ILLLLALVAILWKLGFFKRKYEKMAKNPEEIDETTELNS
NT seq 3540 nt   +upstreamnt  +downstreamnt
atgcggccaggacggacagggggcgcgccgctgcggctggtgttagtgctcagccaaggc
attttaaactgttgtatggcatacaatgtcggtctcccggaagcaaagatattttctggt
ccttcaagtgaacagtttggctatgcggtgcagcagtttctaaatccaaaaggcaactgg
ttactggttggttcaccttggagcggctttcctgagaaccgaatgggagatgtctataag
tgtcctgttgatctatccactgctacgtgtgaaaaactgaatttgcaaacttccacaagc
attcccaatgttaccgagatgaaaaccaacatgagccttggcttgacgctcacaaggaat
gtgggaaccggaggatttcttacatgtggtcccctgtgggcacagcagtgcggaagccaa
tattacacaactggtgtctgttctgacgtcagtcccgattttcagctcttggccagcttt
tcacctgcagctcagacctgcccttccctcatagatgttgtggttgtgtgtgatgaatca
aacagtatttatccctgggaggcagtaaagaattttttggagaaatttgtacaaggcctc
gatataggccccacaaaaacacaggtggggttaattcaatatgccaataatccaagagtt
gtgtttaacctgaacacttttaaaactaaagctgagatggttgaagcgacatcccagaca
ttccaatttggtggggacctcacaaataccttcaaagcaattcaatatgcaagggattct
gcttattcagcagccgctggtggacggcgaggtgctacgaaagtcatggtggttgtaact
gatggtgaatcacatgatggttccatgttgaaagccgtgattgatcagtgcaacagtgac
aatatactgaggtttggcatagcagttcttgggtacttaaacagaaacgcccttgacact
aaaaatttaataaaagaaattaaagcaattgccagtattccaacagaaaggtactttttc
aatgtgtctgatgaagtagccctactagaaaaggctgggacattgggagagcaaattttc
agcatcgaaggcaccgttcaaggaggagacaacttccagatggaaatgtcacaagtggga
ttcagcgcagattactctcctcaaaatgatattctgatgctgggtgcagtgggagcttat
ggctggagtgggactgttgtccaggagtcatctcatggacatttgatctttcctaaacaa
gcctttgaccaaattctgcatgacagaaaccacagctcatatttaggttactccgtggct
gcaatttctactggaaaaggcgtccactttgttgctggtgctcctcgggcaaattatact
ggccagatcgtgctgtacagtgttaatgagaacggcaacatcacaattattcagactcac
agaggtgaccagattggctcctattttggtagtgtgctgtgttcagtggatgtggataaa
gatgccatcacagatgtgctcttggtaggtgcaccgacgtacatgaatgacctaaagaaa
gaggaaggaagagtctacttgtttactatcacaaagggcattttgaattggcaccagttt
cttgaaggccctgatggtgttgaaaacgctcggtttggttcagcgattgcggctctttca
gacatcaacatggatggctttaatgacgtgatagtaggctcgcctttggaaaatcagaac
tctggagctgtgtacatctacaatggtcatgagggcactattcgcttgaagtattcccag
aaaatcctgggctccgacggagcctttaggagccgtctccagtactttgggagagccgtg
gatggccatgaagatttaaacggagattccatcaccgatgtgtccgttggtgcctttgga
caagtggttcagctctggtcacagagtattgctgatgtatctgtagacgcttcattcaca
ccagaaaaaatcactttgttcaacaagaacgctgagataagcctcaaactgtgcttcagt
gctaagtttagacctactaagcaaaacagtcaagtggccattacatataacatcacactt
gatgcagatctatactcatccagagtaacctccaggggtttatttaaagaaaacaatgaa
aggtacctacggaagaatatgatagtaagtcaagctcagaattgctctgagtacatcatc
cacatacaggagccttcagatgttgtcaactctttgggtctgtgtgtgaacattagtctg
gaaaaccctggcactagccctgcccttgaagcttactctgagactgccaaggtcttcagt
attcctttccacaaagactgtggtgatgatggaatttgcatctctgatctagttctacat
gtccaacagctgccagcttctcaagaacaaccctttattgtcagcaaccaaaacaaaagg
ttaacattttcagtaacactgaaaaacaaaaaggaaagtgcatacaacgctggaattgtt
gttgatttttcagaaaatttgttttttgcttcctggtccatgccggttgatgggacggaa
gtaacatgccaggttgcttcatctcagaagtctgttacctgtgatgtaggctaccctgct
ttaaagagaaaacaaaaggtgacttttactattaacttcgacttcaatcttcaaaacctt
cagaatcaggcatctgtcagtttccaagccatgagtgaaagccatgaagaaaacaaggca
gataattcagccaacttcaaaattcctctgctgtatgatgctgatattcacataacaaga
tctaccaacataaatttttatgaagtgtcctcggatgggaatgtttcttctatcgtgcac
aattttgaagatattggtccaaaattcatcttctccattaaggtaaccacaggaagtgtt
ccagtaagcatggcatctgtaatcatccacatccctcaatacaccaaagaaaagaatccg
ttgatgtacctgactggggtggacacagatcaggctggtgacatcagttgtaatgccgaa
ataaatccactgaaaataggacaaacactgtcttcagtatctttcaagagtgaaaatttc
cggcacataaaagaattgaactgcagaacggcttcatgtcgtaacgtgacctgctggctg
acagaccttcagatgaagagtgaatacttcctcaacgtctcgaccagaatttggaacggg
acttttgcagcatcgactttccagacagtacagctgacagcacctgcagaaatcgacacc
tataaccctcagatatatgtgatcgaagaaaacacagtcacgattcccatcaccatcatg
aagccccatgagaaagccgaagtaccaaccggagttatagtgggaagtgtaattgctgga
atccttttgctattagctctggttgcaattttatggaagctcggcttcttcaaaagaaaa
tatgaaaaaatggccaaaaacccagaggagattgacgagaccacagaactcaacagctga

KEGG   Equus caballus (horse): 100064056
Entry
100064056         CDS       T01058                                 

Gene name
ITGA6
Definition
(RefSeq) integrin alpha-6 isoform X1
  KO
K06485  integrin alpha 6
Organism
ecb  Equus caballus (horse)
Pathway
ecb04151  PI3K-Akt signaling pathway
ecb04510  Focal adhesion
ecb04512  ECM-receptor interaction
ecb04514  Cell adhesion molecules
ecb04640  Hematopoietic cell lineage
ecb04810  Regulation of actin cytoskeleton
ecb05145  Toxoplasmosis
ecb05165  Human papillomavirus infection
ecb05200  Pathways in cancer
ecb05222  Small cell lung cancer
ecb05410  Hypertrophic cardiomyopathy
ecb05412  Arrhythmogenic right ventricular cardiomyopathy
ecb05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100064056 (ITGA6)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100064056 (ITGA6)
   04514 Cell adhesion molecules
    100064056 (ITGA6)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100064056 (ITGA6)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100064056 (ITGA6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100064056 (ITGA6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100064056 (ITGA6)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100064056 (ITGA6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100064056 (ITGA6)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100064056 (ITGA6)
   05414 Dilated cardiomyopathy
    100064056 (ITGA6)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100064056 (ITGA6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100064056 (ITGA6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100064056 (ITGA6)
   04515 Cell adhesion molecules [BR:ecb04515]
    100064056 (ITGA6)
   04090 CD molecules [BR:ecb04090]
    100064056 (ITGA6)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100064056 (ITGA6)
  Exosomal proteins of breast milk
   100064056 (ITGA6)
Cell adhesion molecules [BR:ecb04515]
 Integrins
  Integrin alpha subunits
   100064056 (ITGA6)
CD molecules [BR:ecb04090]
 Proteins
  100064056 (ITGA6)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS DUF4381 LRR19-TM
Other DBs
NCBI-GeneID: 100064056
NCBI-ProteinID: XP_014588021
Ensembl: ENSECAG00000001652
VGNC: 19167
LinkDB
Position
18
AA seq 1091 aa
MAAAGPLWLLYLSAGLLARPGTAFNLDTREENVIRKVGDPGSLFGFSLAMHWQLQPEDKR
LLLVGAPRAVALPLQRANRTGGLYSCDITSRGPCTRIEFDNDADPSSESKEDQWMGVTVQ
SQGPGGKVVTCAHRYEKRQHVNTKQESRDIFGRCYVLSQNLRIEDDMDGGDWSFCDGRLR
GHEKFGSCQQGVAATFTKDFHYIVFGAPGTYNWKGIVRVEQKNNTFFDMNIFEDGPYEVG
GETDHDESLVPVPANSYLGFSLDSGKGIVSKDEITFVSGAPRANHSGAVVLLKRDTKSAH
LLPEHIFDGEGLASSFGYDVAVVDLNKDGWQDIVIGAPQYFDRDGEVGGAVYVYINQQGR
WNNVKPIRLNGTKDSMFGIAVKNIGDINQDGYPDIAVGAPYDDMGKVFIYHGAANGINTK
PTQILEGKSPYFGYSIAGNMDLDRNSYPDVAVGSLSDSVTIFRSRPVINIQKTVTVTPNR
IDLRQKTACGAPSGICLKVKACYEYTAKPTGYNPSISIVGTLEAEKERRKSGLSSRVQFR
NQGSEPKYTQELTLNRQKQKMCMEETLWLQENIRDKLRPIPITASVEIQEPNTRRRVNSI
PEVLPILNSNEPKTVHTDVHFLKEGCGNDNVCNSNLKLEYKFCTREGNQDKFSYLPIQKG
VPELVLKDQKDIALEITVTNSPSNPRNPTKDGDDAHEAKLIATFPDTLTYSAYRELRAFP
EKQLSCVANQNGSQADCELGNPFKRNSSVTFYLILSTTEVTFDTRDLDINLKLETTSNQD
NLAPITATAKVVIELLLSVSGVAKPSQVYFGGTVLGEQAMKSEDEVGSLIEYEFRVINLG
KPLKNLGTATLNIQWPKEISNGKWLLYLVKVESKGLDKIACEPQNEINLLRLKESHNSRK
KREIAEKQIDDNRKFSLFAERKYQTLNCTVNVNCVTIKCPLRGLDSKASVVLRSRLWNST
FLEEYSKMNYLDILVRASIDVTAATENIKLPNAGTQVRVTVFPSKTVAHYSGVAWWIILV
AILAGILMLALLVYILWKCGFFKRSRYDDSVPRYHAVRIRKEEREIKDEKYNDNFEKKQW
ITRWNENESYS
NT seq 3276 nt   +upstreamnt  +downstreamnt
atggcggccgcggggcccttgtggctgctctacctgtcggcggggctcctggctcggccc
ggcaccgccttcaacttggacacccgcgaggagaatgtgatccggaaagtgggggacccc
gggagcctcttcggcttctcgttggccatgcactggcagctgcagcccgaggacaagcgg
ctgttgctggtgggggccccacgggcagtggcccttccactgcagagggccaacagaacg
ggaggcttgtacagctgtgacatcacttcccgagggccttgcacacggattgaatttgat
aatgatgctgacccttcatcggaaagcaaggaagatcagtggatgggggtcaccgtccag
agccagggtccagggggcaaagttgtgacatgtgctcatcgatatgaaaaaaggcaacat
gttaacacaaagcaggaatcccgagacatctttggaaggtgttatgtcctgagtcagaat
ctcaggattgaagatgatatggatggaggagactggagtttttgtgacggccgattgaga
ggccatgaaaaatttggttcttgccagcaaggtgtggcagcgacttttactaaagacttt
cattacattgtatttggagccccgggcacttataactggaaagggattgttcgcgtagag
caaaagaataacactttttttgacatgaacatctttgaagatgggccttatgaagttggt
ggagagactgaccatgatgaaagtctagttcctgttcctgctaacagttacttaggcttt
tctttggactcagggaaaggtattgtttctaaagatgagatcacttttgtatctggtgct
ccaagagccaatcacagtggagctgtggttttgctaaaaagggacacgaagtctgcacat
cttcttcctgagcacatatttgacggggaaggtctggcttcttcctttggctatgacgtg
gcagtggtggaccttaataaagatgggtggcaagatatagtgattggagcgccacagtat
tttgatagagatggagaagttggaggggcagtgtatgtctacattaaccagcaaggcaga
tggaataatgtcaagccaattcgtcttaatggaaccaaagattctatgtttggcatcgca
gtgaaaaatattggagatattaatcaagacggctacccagatatcgcagttggagctccc
tatgatgatatgggaaaggtttttatctatcatggagccgcgaacggaataaataccaaa
ccaacacagattctcgagggtaaatcgccttattttggatattcaattgctggaaatatg
gaccttgatagaaattcctaccctgatgtcgctgttggttccctctcagattcagtaact
attttcagatcccggcctgtgattaacattcagaaaaccgtcacagtaacacctaacaga
attgatctccgccagaaaacagcctgcggggcgcccagcgggatatgcctcaaggttaag
gcctgttatgaatatactgccaaacccactggttacaatccttcaatatctattgtcggc
acgctcgaggctgaaaaagagagaagaaaatctgggctgtcctcaagagttcagtttcga
aaccaaggttctgagcccaagtatactcaagaactcacgctgaacaggcagaagcagaag
atgtgcatggaggaaaccctctggctccaggaaaatatcagagataaactgcggcccatt
cccataactgcttccgtagagattcaagagccaaacactcggaggcgagtgaattcaatt
ccagaagttcttccaattctgaattcaaacgaacccaaaacagtacatacagacgtgcac
ttcttaaaagagggatgtggaaacgacaatgtctgtaacagcaaccttaagctagaatat
aaattttgtacccgagaaggaaatcaagacaaattttcttatttaccaattcaaaaaggt
gtaccggaactcgttctaaaagatcagaaggacattgctctagaaataacagtgacaaac
agcccttccaacccaaggaaccccacaaaggatggtgatgacgctcatgaagctaaactc
attgcgacgtttccagacactttgacttactctgcatatagagagctgagggctttccct
gagaaacagctgagttgtgttgccaatcaaaacggctcacaagcagactgtgaacttgga
aatccttttaaaagaaattccagtgttactttttatttgattttaagtacaactgaggtc
acctttgacaccagagatctggatattaatctgaagttggaaacaacaagcaatcaagat
aatttggctccaattacagctacagcaaaagtggttattgaactgcttttatcggtctcc
ggagttgctaaaccttcccaggtttattttggaggtacagttcttggtgagcaagctatg
aaatctgaggatgaagtgggaagtttgatagagtatgagttcagggtaattaacttgggg
aaacctcttaaaaacctcggcacggcaaccttgaacatccagtggccaaaagaaattagc
aatggcaaatggttgctttatttggtgaaagtagaatccaaaggattggataagatagct
tgtgagccacaaaatgaaataaacctcctgagactaaaggagtctcacaactcaagaaag
aaacgggaaattgccgaaaaacagatagatgataacagaaaattttctttatttgctgaa
agaaaataccagactctcaactgcactgtgaacgtgaactgtgtgaccatcaagtgtccc
ctgcgagggctcgacagcaaggcctctgttgttttgcgctcaaggttatggaatagcaca
tttctagaggaatattccaaaatgaactacttggacattctcgtgcgggcttccattgat
gtaactgctgccaccgagaatatcaagctgccaaacgcaggcactcaggttcgtgtgact
gtgtttccttcaaagactgtagctcactattcaggagtagcttggtggatcatcctagtg
gctattcttgctgggattttgatgcttgctctcttagtgtatatactctggaagtgtgga
ttctttaaacgctctaggtacgatgatagcgttccccgataccatgctgtaaggatccgg
aaagaagagcgagagatcaaagatgaaaaatataatgataactttgaaaaaaaacagtgg
atcacaaggtggaatgaaaatgaaagctactcctag

KEGG   Equus caballus (horse): 100068706
Entry
100068706         CDS       T01058                                 

Gene name
ITGAV
Definition
(RefSeq) integrin alpha-V isoform X1
  KO
K06487  integrin alpha V
Organism
ecb  Equus caballus (horse)
Pathway
ecb04145  Phagosome
ecb04151  PI3K-Akt signaling pathway
ecb04510  Focal adhesion
ecb04512  ECM-receptor interaction
ecb04514  Cell adhesion molecules
ecb04810  Regulation of actin cytoskeleton
ecb04919  Thyroid hormone signaling pathway
ecb05163  Human cytomegalovirus infection
ecb05165  Human papillomavirus infection
ecb05200  Pathways in cancer
ecb05205  Proteoglycans in cancer
ecb05222  Small cell lung cancer
ecb05410  Hypertrophic cardiomyopathy
ecb05412  Arrhythmogenic right ventricular cardiomyopathy
ecb05414  Dilated cardiomyopathy
ecb05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100068706 (ITGAV)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100068706 (ITGAV)
   04514 Cell adhesion molecules
    100068706 (ITGAV)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100068706 (ITGAV)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100068706 (ITGAV)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100068706 (ITGAV)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100068706 (ITGAV)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100068706 (ITGAV)
   05205 Proteoglycans in cancer
    100068706 (ITGAV)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100068706 (ITGAV)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100068706 (ITGAV)
   05410 Hypertrophic cardiomyopathy
    100068706 (ITGAV)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100068706 (ITGAV)
   05414 Dilated cardiomyopathy
    100068706 (ITGAV)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    100068706 (ITGAV)
   05165 Human papillomavirus infection
    100068706 (ITGAV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ecb04131]
    100068706 (ITGAV)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ecb04147]
    100068706 (ITGAV)
   04515 Cell adhesion molecules [BR:ecb04515]
    100068706 (ITGAV)
   04090 CD molecules [BR:ecb04090]
    100068706 (ITGAV)
Membrane trafficking [BR:ecb04131]
 Endocytosis
  Phagocytosis
   Integrins (complement receptors)
    100068706 (ITGAV)
Exosome [BR:ecb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100068706 (ITGAV)
  Exosomal proteins of epithelial cells
   100068706 (ITGAV)
Cell adhesion molecules [BR:ecb04515]
 Integrins
  Integrin alpha subunits
   100068706 (ITGAV)
CD molecules [BR:ecb04090]
 Proteins
  100068706 (ITGAV)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha LYRIC
Other DBs
NCBI-GeneID: 100068706
NCBI-ProteinID: XP_023477934
Ensembl: ENSECAG00000022653
VGNC: 19174
LinkDB
Position
18
AA seq 1047 aa
MASPPPRPLRFRPRRLLLPLLGFLLPLCGAFNLDVDSPAEYSGPEGSYFGFAVDFFVPSA
SSRMFLLVGAPKANTTQPGIVEGGQVLKCDWSSHRGCQPIEFDATGNRDYAKDDPLEFKS
HQWFGASVRSKQDKILACAPLYHWRTEMKQEREPVGTCFLQDGAKTVEYAPCRSKNIDAD
GQGFCQGGFSIDFTKADRVLLGGPGSFYWQGQLISDQVAEIVSKYDPKVYSIKYNNQLAT
RTAQAIFDDSYLGYSVAVGDFNGDGIDDFVSGVPRAARTLGMVYIYDGKNMSSLHNFTGE
QMAAYFGFSVAATDINGDDYADVFIGAPLFMDRGSDGKLQEVGQVSVSLQRASGDFQTTK
LNGFEVFARFGSAIAPLGDLDQDGFNDIAIAAPYGGEDKKGIVYIFNGRSTGLNSVPSQI
LEGKWAARSMPPSFGYSMKGATDIDKNGYPDLLVGAFGVDRAVLYRARPVITVNAGLEVY
PSILNQDNKTCPLPGTDLKVSCFNVRFCLKADGKGAVPTKLNFQVELLLDKLKQKGAIRR
ALFLHNRSPGHSKNMTISRGGQMQCEELIAYLRDESEFRDKLTPITIFMEYRLDYRTAAD
ATGLQPILNQFTPANISRQAHILLDCGEDNVCKPKLEVSVDSDQKKIYIGDDNPLTLIVK
AQNQGEGAYEAELIISIPPQADFIGVVRNSEALARLSCAFKTENQTRQVVCDLGNPMKAG
TQLLAGLRFSVHQQSEMDTSVKFDLQIQSSNLFDKVSPVVSYKADLAVLAAVEIRGVSSP
DHIFLPIPNWEHKENPDTEEDVGPVVQHIYELRNNGPSSFSKAMLNLQWPYKYNNNTLLY
ILQYDIDGPMNCTSDMEINPLRIKISNSQTEKNDTVSGQGDRNHLITKRDLTLTEGDVHT
LGCGIAECLKIVCQVGRLDRGKSAILYVRSLLWTETFMNKENQNHSYSLKSSASFNVIEF
PYKNLPIEDIFNSTLVTTDVTWGIQPAPMPVPVWVIILAVLAGLLLLAVLVFVMYRMGFF
KRVRPPQEEQEREQLQPHENGEGNSET
NT seq 3144 nt   +upstreamnt  +downstreamnt
atggcttctccgccgccgcggccgctgcgctttcgcccccgacgcctcctgctccctctc
ctcggattcctgctgcctctgtgcggcgccttcaacctggacgtggacagtcctgccgag
tactccggccccgagggaagttacttcggcttcgcggtggatttcttcgtgcccagcgcg
tcttccaggatgtttcttcttgtgggagcccccaaagcaaacaccacccagccggggatc
gtggaaggagggcaagtcctcaagtgtgactggtcttctcaccgagggtgccagccgatt
gaatttgacgccacaggcaatagagattatgccaaggatgatccattggagtttaagtcc
caccagtggtttggagcatctgtgagatccaaacaggataaaattttggcctgtgcccca
ctctaccactggaggacggaaatgaaacaggaaagagagccggttggaacgtgctttctt
caagatggagcaaagactgttgagtatgctccatgcagatcaaaaaatattgatgctgat
ggacagggattttgtcaaggaggattcagcattgattttactaaagctgacagagtactt
cttggtggtcctggtagtttttattggcaaggtcagctcatttcagatcaagtggcagaa
attgtatctaaatatgaccccaaagtttacagcatcaaatataataaccagctagcaact
cgaaccgcccaagctatttttgatgacagttatttgggttactcggtggctgttggagat
ttcaatggtgatggcatagatgactttgtttcaggagttccaagagcagcgaggacattg
ggaatggtttacatttacgatgggaagaacatgtcctccttgcacaattttactggtgag
cagatggctgcatactttggattttcggtcgctgccactgacattaacggtgatgattat
gcagacgtatttattggagcacctctcttcatggatcgtggttctgatggcaaactccag
gaggtggggcaggtctcagtgtctctgcaaagggcttcgggagatttccagacgaccaag
ctgaatgggtttgaggtctttgcgaggtttggcagtgccatcgcacctttgggagatctg
gaccaggatggtttcaatgatattgcaattgctgctccatatgggggtgaagataaaaaa
ggaattgtttatattttcaatggaagatcaacaggcttgaattcggtcccatcgcagatc
cttgaagggaagtgggctgctcggagcatgccccccagctttggctattcaatgaaagga
gccacggatatagacaaaaatggatatccagacttacttgtaggagcttttggtgtagat
agagctgtattatacagggccagaccagttatcaccgtaaatgctggccttgaagtatac
cctagcattttaaatcaagataataaaacttgcccactgcctgggacagatcttaaagtt
tcctgttttaatgtcaggttctgcttaaaggcagatggcaaaggagcagttcctacgaaa
cttaacttccaggtggagcttcttttggataaactcaagcaaaaaggagccattcgacga
gcactgtttctccataacaggtccccgggtcactccaagaacatgaccatttcaaggggg
ggacagatgcagtgcgaggaactgatagcgtatctgcgggatgaatctgaatttagagac
aaactcactccgattactatttttatggagtatcggttggattacagaacggctgctgat
gcaacaggcttacaacccattcttaaccagttcactcctgccaacattagtcgacaggct
catattctccttgactgtggtgaagacaatgtctgtaaacccaaactggaagtttctgtg
gatagtgatcaaaagaaaatctatataggggacgacaatcctctgacattgattgttaaa
gctcagaatcaaggagaaggtgcctatgaagcggagctcatcatttccatcccaccgcag
gctgatttcatcggggttgtccgcaacagtgaagccttagcaagactttcctgtgcattt
aagacagaaaaccaaacccgccaagtggtatgtgaccttggaaacccaatgaaggctgga
actcaactcttagctggtcttcgtttcagcgtgcaccagcaatcagagatggatacttct
gtgaaatttgatttgcagatccaaagctccaatctttttgacaaagtaagcccagttgta
tcttacaaagctgaccttgctgttttagctgctgttgagataagaggagtctcaagtcct
gatcatatctttcttccgattccgaattgggagcacaaggagaaccctgacactgaggaa
gacgttgggccagtcgttcagcacatctatgagctgagaaacaacggtccaagttcattc
agcaaggcaatgctaaaccttcagtggccttacaaatacaacaataacaccttgctctac
atcctgcaatacgatattgatgggccaatgaactgcacctcagatatggagatcaaccct
ttgaggattaagatctcaaattcgcaaactgaaaagaatgacacagtttctgggcaaggt
gaccggaaccatctcatcactaagcgagatctcaccctcactgaaggagacgttcacact
ttgggttgtggaattgctgaatgcttgaagattgtctgccaggttgggcggctagacaga
ggaaagagtgcaatcctgtatgtgaggtctctgctgtggaccgagacctttatgaataag
gaaaaccagaatcattcatattctctgaagtcatcggcttcatttaatgtcatcgagttt
ccttataagaaccttccaattgaggatatcttcaactccacattagtcaccactgatgtc
acctggggcattcagccagcacccatgcctgtgcctgtatgggtgatcattttagcagtt
ctagcagggttgttgttactggctgttttggtatttgtaatgtacaggatgggctttttt
aaacgtgtccggccacctcaagaagagcaagaaagagaacagcttcaacctcatgaaaat
ggtgaaggaaactcagaaacttaa

DBGET integrated database retrieval system