KEGG   Equus caballus (horse): 100033843
Entry
100033843         CDS       T01058                                 

Gene name
SMAD2
Definition
(RefSeq) mothers against decapentaplegic homolog 2 isoform X1
  KO
K04500  mothers against decapentaplegic homolog 2
Organism
ecb  Equus caballus (horse)
Pathway
ecb04110  Cell cycle
ecb04144  Endocytosis
ecb04218  Cellular senescence
ecb04350  TGF-beta signaling pathway
ecb04371  Apelin signaling pathway
ecb04390  Hippo signaling pathway
ecb04550  Signaling pathways regulating pluripotency of stem cells
ecb04659  Th17 cell differentiation
ecb04926  Relaxin signaling pathway
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb05142  Chagas disease
ecb05166  Human T-cell leukemia virus 1 infection
ecb05200  Pathways in cancer
ecb05205  Proteoglycans in cancer
ecb05210  Colorectal cancer
ecb05212  Pancreatic cancer
ecb05225  Hepatocellular carcinoma
ecb05226  Gastric cancer
ecb05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    100033843 (SMAD2)
   04390 Hippo signaling pathway
    100033843 (SMAD2)
   04371 Apelin signaling pathway
    100033843 (SMAD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100033843 (SMAD2)
  09143 Cell growth and death
   04110 Cell cycle
    100033843 (SMAD2)
   04218 Cellular senescence
    100033843 (SMAD2)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100033843 (SMAD2)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100033843 (SMAD2)
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100033843 (SMAD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100033843 (SMAD2)
   05205 Proteoglycans in cancer
    100033843 (SMAD2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100033843 (SMAD2)
   05212 Pancreatic cancer
    100033843 (SMAD2)
   05225 Hepatocellular carcinoma
    100033843 (SMAD2)
   05226 Gastric cancer
    100033843 (SMAD2)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100033843 (SMAD2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100033843 (SMAD2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100033843 (SMAD2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100033843 (SMAD2)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 100033843
NCBI-ProteinID: XP_023503532
Ensembl: ENSECAG00000015132
VGNC: 23311
LinkDB
Position
8
AA seq 467 aa
MSSILPFTPPVVKRLLGWKKSAGGSGGAGGGEQNGQEEKWCEKAVKSLVKKLKKTGRLDE
LEKAITTQNCNTKCVTIPSTCSEIWGLSTPNTIDQWDTTGLYSFSEQTRSLDGRLQVSHR
KGLPHVIYCRLWRWPDLHSHHELKAIENCEYAFNLKKDEVCVNPYHYQRVETPVLPPVLV
PRHTEILTELPPLDDYTHSIPENTNFPAGIEPQSNYIPETPPPGYISEDGETSDQQLNQS
MDTGSPAELSPTTLSPVNHSLDLQPVTYSEPAFWCSIAYYELNQRVGETFHASQPSLTVD
GFTDPSNSERFCLGLLSNVNRNATVEMTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSP
NCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVK
GWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSVRCSSMS
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgtcgtccatcttgccgttcactccgccagttgtaaagagactgctgggatggaagaaa
tcagctggtgggtctggaggagcaggtggaggagagcagaatggacaggaagagaagtgg
tgtgagaaagcagttaaaagtttggtgaagaagctaaagaaaacaggacgattagatgag
cttgagaaagccatcaccactcaaaattgtaatactaaatgtgttaccataccaagcact
tgctctgaaatttggggactgagtacaccaaatacgatagatcagtgggatacaacaggc
ctttacagcttctctgaacaaaccaggtctcttgatggtcgtcttcaggtatctcatcga
aaaggactgccacatgttatatattgccgattgtggcgctggcctgatcttcacagtcat
catgaactcaaagcaattgaaaactgcgaatatgcttttaatcttaaaaaggatgaagta
tgtgtaaacccttaccactaccagagagttgagacaccagttctgcctcccgtgttagtg
ccgcggcacactgaaatcctgacagaactcccgcctctggatgactatacccactccatc
ccagagaacactaacttcccagcggggatcgagccacagagtaattatatcccagaaacg
ccacctcctggatatatcagtgaagatggagaaacaagtgatcaacagttgaaccaaagt
atggatacaggatctccagcagaactatctcctactactctttcccctgttaatcatagt
ttggatttgcagccagttacttactcagaacctgcattttggtgttcaatagcatattat
gaattaaaccagagggtcggagagaccttccatgcatcacagccctcactcactgtagac
ggcttcacagatccatcaaattcagagaggttctgcttaggtttactctccaacgtcaac
cgaaatgctacggtagaaatgacaagaagacatatagggagaggagtgcgcttatattac
atcggtggggaagtgtttgctgagtgcctaagtgatagtgcaatctttgtgcagagcccc
aactgtaatcagagatatggttggcacccggcaaccgtgtgtaaaatcccaccaggctgt
aatctgaagatcttcaacaaccaggaatttgctgctcttctggctcagtctgttaatcag
ggttttgaagccgtgtaccagctaactagaatgtgcaccataagaatgagttttgtgaaa
gggtggggagcagaataccgaaggcagacggtaacaagcactccttgctggattgaactg
catctgaatggacccctacagtggttggacaaagtattaactcagatgggatccccatca
gtgcgttgctcaagcatgtcataa

KEGG   Equus caballus (horse): 100033845
Entry
100033845         CDS       T01058                                 

Gene name
SMAD3
Definition
(RefSeq) mothers against decapentaplegic homolog 3 isoform X1
  KO
K23605  mothers against decapentaplegic homolog 3
Organism
ecb  Equus caballus (horse)
Pathway
ecb04068  FoxO signaling pathway
ecb04110  Cell cycle
ecb04144  Endocytosis
ecb04218  Cellular senescence
ecb04310  Wnt signaling pathway
ecb04350  TGF-beta signaling pathway
ecb04371  Apelin signaling pathway
ecb04390  Hippo signaling pathway
ecb04520  Adherens junction
ecb04550  Signaling pathways regulating pluripotency of stem cells
ecb04659  Th17 cell differentiation
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb05161  Hepatitis B
ecb05166  Human T-cell leukemia virus 1 infection
ecb05200  Pathways in cancer
ecb05210  Colorectal cancer
ecb05212  Pancreatic cancer
ecb05220  Chronic myeloid leukemia
ecb05225  Hepatocellular carcinoma
ecb05226  Gastric cancer
ecb05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100033845 (SMAD3)
   04350 TGF-beta signaling pathway
    100033845 (SMAD3)
   04390 Hippo signaling pathway
    100033845 (SMAD3)
   04371 Apelin signaling pathway
    100033845 (SMAD3)
   04068 FoxO signaling pathway
    100033845 (SMAD3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100033845 (SMAD3)
  09143 Cell growth and death
   04110 Cell cycle
    100033845 (SMAD3)
   04218 Cellular senescence
    100033845 (SMAD3)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100033845 (SMAD3)
   04550 Signaling pathways regulating pluripotency of stem cells
    100033845 (SMAD3)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100033845 (SMAD3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100033845 (SMAD3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100033845 (SMAD3)
   05212 Pancreatic cancer
    100033845 (SMAD3)
   05225 Hepatocellular carcinoma
    100033845 (SMAD3)
   05226 Gastric cancer
    100033845 (SMAD3)
   05220 Chronic myeloid leukemia
    100033845 (SMAD3)
  09163 Immune disease
   05321 Inflammatory bowel disease
    100033845 (SMAD3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100033845 (SMAD3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100033845 (SMAD3)
   05161 Hepatitis B
    100033845 (SMAD3)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 100033845
NCBI-ProteinID: XP_023510748
Ensembl: ENSECAG00000020259
VGNC: 23312
LinkDB
Position
1
AA seq 425 aa
MSSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNV
NTKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLHSHHELRAMELCEFAFNMKKDEV
CVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTNFPAGIEPQSNIPETP
PPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYEL
NQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVELTRRHIGRGVRLYYIG
GEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGF
EAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIR
CSSVS
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgtcgtccatcctgcccttcaccccgccgatcgtgaagcgcctgctgggctggaagaag
ggcgagcagaacgggcaggaggagaagtggtgcgagaaggcggtcaagagtttggtcaag
aagctcaagaagacggggcagctggacgagctggagaaggccatcaccacgcagaacgtc
aacaccaagtgcattaccatccccaggtccctggatggcagactgcaggtgtcccatcgg
aaggggctcccgcacgtcatctactgccgcctgtggcgatggcccgacctacacagccac
catgagctgcgggccatggagctgtgtgagttcgccttcaacatgaagaaggacgaggtc
tgcgtgaacccctaccactatcagagggtggagaccccagttctacctcctgtgttggtg
ccacgccacacagagatcccggccgagttccccccactggatgactacagccattccatc
cccgaaaacactaacttccccgcgggcatcgagccccagagcaatattccagaaacccca
ccccctggctacctgagtgaagatggagagaccagcgaccaccagatgaaccacagcatg
gatgcaggttctccaaacctatccccaaatccgatgtccccagcacacaataacttggac
ctgcagcccgtcacctactgcgagccggccttctggtgctccatctcctactatgagctg
aaccagcgcgtcggggagacattccacgcctcgcagccctccatgacggtggatggcttc
accgacccctccaactcggagcgcttctgcctagggctgctctccaacgtcaacaggaac
gcggccgtggagctcacgcggaggcacatcgggcggggcgtgcggctgtactacatcgga
ggggaggtcttcgcagagtgcctcagcgacagcgctatcttcgtccagtctcccaactgt
aaccagcgttatggctggcacccggccaccgtctgcaagatccccccaggatgcaacctg
aagatcttcaacaaccaggagtttgcagccctcctggcgcagtcagtcaaccagggcttc
gaggccgtctaccagttgacacgaatgtgcaccatccgcatgagcttcgtcaaaggctgg
ggagcagaatacaggagacagacagtgaccagcaccccctgctggatcgagctgcacctg
aatgggcctttgcagtggcttgacaaggtcctcacccagatgggctccccaagtatccgc
tgttccagcgtgtcttag

DBGET integrated database retrieval system