KEGG   Equus caballus (horse): 100033846
Entry
100033846         CDS       T01058                                 

Gene name
SMAD4
Definition
(RefSeq) mothers against decapentaplegic homolog 4
  KO
K04501  mothers against decapentaplegic homolog 4
Organism
ecb  Equus caballus (horse)
Pathway
ecb04068  FoxO signaling pathway
ecb04110  Cell cycle
ecb04310  Wnt signaling pathway
ecb04350  TGF-beta signaling pathway
ecb04371  Apelin signaling pathway
ecb04390  Hippo signaling pathway
ecb04520  Adherens junction
ecb04550  Signaling pathways regulating pluripotency of stem cells
ecb04659  Th17 cell differentiation
ecb04933  AGE-RAGE signaling pathway in diabetic complications
ecb05161  Hepatitis B
ecb05166  Human T-cell leukemia virus 1 infection
ecb05200  Pathways in cancer
ecb05210  Colorectal cancer
ecb05212  Pancreatic cancer
ecb05220  Chronic myeloid leukemia
ecb05225  Hepatocellular carcinoma
ecb05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ecb00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100033846 (SMAD4)
   04350 TGF-beta signaling pathway
    100033846 (SMAD4)
   04390 Hippo signaling pathway
    100033846 (SMAD4)
   04371 Apelin signaling pathway
    100033846 (SMAD4)
   04068 FoxO signaling pathway
    100033846 (SMAD4)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100033846 (SMAD4)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100033846 (SMAD4)
   04550 Signaling pathways regulating pluripotency of stem cells
    100033846 (SMAD4)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    100033846 (SMAD4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100033846 (SMAD4)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100033846 (SMAD4)
   05212 Pancreatic cancer
    100033846 (SMAD4)
   05225 Hepatocellular carcinoma
    100033846 (SMAD4)
   05226 Gastric cancer
    100033846 (SMAD4)
   05220 Chronic myeloid leukemia
    100033846 (SMAD4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100033846 (SMAD4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100033846 (SMAD4)
   05161 Hepatitis B
    100033846 (SMAD4)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 100033846
NCBI-ProteinID: XP_023503588
Ensembl: ENSECAG00000017857
VGNC: 23313
LinkDB
Position
8
AA seq 552 aa
MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITA
ITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFD
LKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPPSMLVKDEYVHDFEGQPSLSTEGHSIQ
TIQHPPSNRASTETYSTPALLAPSESNATSTTNFPNIPVASTSQPPSILAGSHSEGLLQI
ASGPQPGQQQNGFTGQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGH
YWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGD
RFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGR
APGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAP
AISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVL
HTMPIADPQPLD
NT seq 1659 nt   +upstreamnt  +downstreamnt
atggacaatatgtctattacgaatacaccaacaagtaatgatgcctgtctgagcattgta
catagtttgatgtgccatagacaaggtggagagagtgaaacatttgcaaaaagagcaatt
gaaagtttggtgaagaagctgaaggagaaaaaagatgaattggattctttaataacagct
ataactacaaatggagctcatcctagcaaatgtgttaccatacagagaacgttggatggc
aggcttcaggtggctggtcggaaaggatttcctcatgtgatctatgcccgtctctggagg
tggcctgatcttcacaaaaacgaactaaaacatgttaaatattgtcagtatgcatttgac
ttaaaatgtgatagtgtctgtgtgaatccatatcactatgaacgagttgtatcacctgga
attgatctctcaggattaacactgcagagtaatgctccaccaagtatgttggtgaaggat
gaatatgttcatgactttgagggacagccatcgttatccactgaagggcattcaattcaa
accatccagcatccgccaagtaatcgtgcgtcgacggagacgtacagcacaccagctctg
ttagctccatctgagtcgaatgctaccagtaccaccaactttcccaacattcctgtggct
tccacaagtcagcctcccagtatactggcaggcagccatagtgaaggattgttgcagata
gcttcagggcctcagccaggacagcagcagaatggatttactggtcagccagctacttac
catcataacagcactaccacctggactggaagtaggaccgcaccatacacacctaatttg
cctcaccaccaaaacggccatcttcagcaccacccgcctatgccgccccatcccggacat
tactggccagttcacaatgagcttgcattccagcctcccatttccaatcaccctgctcct
gagtattggtgttccattgcttactttgaaatggatgttcaagtcggagagacatttaag
gttccttcaagctgccctattgttactgttgatggatatgtggacccttctggaggagat
cgcttttgcttgggtcaactctccaatgtccacaggacagaagccattgagagagcaagg
ttgcacataggcaaaggtgtgcagttggaatgtaaaggtgaaggtgatgtttgggtcagg
tgccttagcgaccatgcagtctttgtacagagttactacttagacagagaagctgggcgt
gcacctggagatgctgttcataagatctacccaagtgcgtatataaaggtctttgatttg
cgtcagtgtcaccgtcagatgcagcaacaggcggccactgcacaagctgcagcagccgcc
caggccgcagccgtggcaggaaacatccctggcccgggctcagtaggtggaatagctcca
gctatcagtttgtcagctgctgccggaattggtgttgatgaccttcgtcgcttatgcata
ctcaggatgagttttgtgaaaggctggggaccggattacccaagacagagcatcaaagaa
acaccttgctggattgagattcacttacaccgggccctccagctcctagatgaagtcctt
cacaccatgcctattgctgacccacaacctttagactga

DBGET integrated database retrieval system